KEGG   Homo sapiens (human): 1803Help
Entry
1803              CDS       T01001                                 

Gene name
DPP4, ADABP, ADCP2, CD26, DPPIV, TP103
Definition
(RefSeq) dipeptidyl peptidase 4 (EC:3.4.14.5)
  KO
K01278  
dipeptidyl-peptidase 4 [EC:3.4.14.5]
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Drug target
Alogliptin: 
Anagliptin: 
Carmegliptin (DG01281): 
Denagliptin tosylate: 
Dutogliptin (DG01282): 
Gosogliptin: 
Linagliptin: 
Omarigliptin: 
Saxagliptin (DG00119): 
Sitagliptin (DG00118): 
Teneligliptin (DG01283): 
Trelagliptin (DG01284): 
Vildagliptin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1803 (DPP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     1803 (DPP4)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   1803 (DPP4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1803 (DPP4)
  Exosomal proteins of epithelial cells
   1803 (DPP4)
  Exosomal proteins of colorectal cancer cells
   1803 (DPP4)
Cellular antigens [BR:hsa04090]
 Proteins
  1803 (DPP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q24.3
AA seq 766 aa AA seqDB search
MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaccgtggaaggttcttctgggactgctgggtgctgctgcgcttgtcaccatc
atcaccgtgcccgtggttctgctgaacaaaggcacagatgatgctacagctgacagtcgc
aaaacttacactctaactgattacttaaaaaatacttatagactgaagttatactcctta
agatggatttcagatcatgaatatctctacaaacaagaaaataatatcttggtattcaat
gctgaatatggaaacagctcagttttcttggagaacagtacatttgatgagtttggacat
tctatcaatgattattcaatatctcctgatgggcagtttattctcttagaatacaactac
gtgaagcaatggaggcattcctacacagcttcatatgacatttatgatttaaataaaagg
cagctgattacagaagagaggattccaaacaacacacagtgggtcacatggtcaccagtg
ggtcataaattggcatatgtttggaacaatgacatttatgttaaaattgaaccaaattta
ccaagttacagaatcacatggacggggaaagaagatataatatataatggaataactgac
tgggtttatgaagaggaagtcttcagtgcctactctgctctgtggtggtctccaaacggc
acttttttagcatatgcccaatttaacgacacagaagtcccacttattgaatactccttc
tactctgatgagtcactgcagtacccaaagactgtacgggttccatatccaaaggcagga
gctgtgaatccaactgtaaagttctttgttgtaaatacagactctctcagctcagtcacc
aatgcaacttccatacaaatcactgctcctgcttctatgttgataggggatcactacttg
tgtgatgtgacatgggcaacacaagaaagaatttctttgcagtggctcaggaggattcag
aactattcggtcatggatatttgtgactatgatgaatccagtggaagatggaactgctta
gtggcacggcaacacattgaaatgagtactactggctgggttggaagatttaggccttca
gaacctcattttacccttgatggtaatagcttctacaagatcatcagcaatgaagaaggt
tacagacacatttgctatttccaaatagataaaaaagactgcacatttattacaaaaggc
acctgggaagtcatcgggatagaagctctaaccagtgattatctatactacattagtaat
gaatataaaggaatgccaggaggaaggaatctttataaaatccaacttagtgactataca
aaagtgacatgcctcagttgtgagctgaatccggaaaggtgtcagtactattctgtgtca
ttcagtaaagaggcgaagtattatcagctgagatgttccggtcctggtctgcccctctat
actctacacagcagcgtgaatgataaagggctgagagtcctggaagacaattcagctttg
gataaaatgctgcagaatgtccagatgccctccaaaaaactggacttcattattttgaat
gaaacaaaattttggtatcagatgatcttgcctcctcattttgataaatccaagaaatat
cctctactattagatgtgtatgcaggcccatgtagtcaaaaagcagacactgtcttcaga
ctgaactgggccacttaccttgcaagcacagaaaacattatagtagctagctttgatggc
agaggaagtggttaccaaggagataagatcatgcatgcaatcaacagaagactgggaaca
tttgaagttgaagatcaaattgaagcagccagacaattttcaaaaatgggatttgtggac
aacaaacgaattgcaatttggggctggtcatatggagggtacgtaacctcaatggtcctg
ggatcgggaagtggcgtgttcaagtgtggaatagccgtggcgcctgtatcccggtgggag
tactatgactcagtgtacacagaacgttacatgggtctcccaactccagaagacaacctt
gaccattacagaaattcaacagtcatgagcagagctgaaaattttaaacaagttgagtac
ctccttattcatggaacagcagatgataacgttcactttcagcagtcagctcagatctcc
aaagccctggtcgatgttggagtggatttccaggcaatgtggtatactgatgaagaccat
ggaatagctagcagcacagcacaccaacatatatatacccacatgagccacttcataaaa
caatgtttctctttaccttag

DBGET integrated database retrieval system