KEGG   Homo sapiens (human): 1808Help
Entry
1808              CDS       T01001                                 

Gene name
DPYSL2, CRMP-2, CRMP2, DHPRP2, DRP-2, DRP2, N2A3, ULIP-2, ULIP2
Definition
dihydropyrimidinase-like 2
Orthology
K07528  
dihydropyrimidinase-like 2
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    1808 (DPYSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p22-p21
AA seq 677 aa AA seqDB search
MAERKQSGKAAEDEEVPAFFKNLGSGSPKPRQKFCGMFCPVEGSSENKTIDFDSLSVGRG
SGQVVAQQRDVAHLGPDPQPPYSRQGRRAGGEPSVESGRKVEIRRASGKEALQNINDQSD
RLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTR
FQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDY
SLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIA
QVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKV
MSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPD
FLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKM
DENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFE
GMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVP
RGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTT
QRIVAPPGGRANITSLG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagaaagcaatccgggaaggcggcagaggacgaagaggtccctgcttttttt
aaaaacctgggctccggcagccccaagccccggcagaaattctgtggcatgttctgcccg
gtggaagggtcctcggagaacaagaccatcgacttcgactcgctgtcggtgggccggggc
tcggggcaggtggtggctcagcagcgggacgtcgcccacttgggcccggacccgcagccg
ccgtactcgcggcagggccggcgcgccggcggagagccatctgttgaatcgggccggaag
gtggagatccggagggcctcgggcaaagaagccctgcagaacatcaacgaccagagcgat
cgtcttctgatcaaaggaggtaaaattgttaatgatgaccagtcgttctatgcagacata
tacatggaagatgggttgatcaagcaaataggagaaaatctgattgtgccaggaggagtg
aagaccatcgaggcccactcccggatggtgatccccggaggaattgacgtccacactcgt
ttccagatgcctgatcagggaatgacgtctgctgatgatttcttccaaggaaccaaggcg
gccctggctgggggaaccactatgatcattgaccacgttgttcctgagcctgggacaagc
ctgctcgctgcctttgaccagtggagggaatgggccgacagcaagtcctgctgtgactac
tctctgcatgtggacatcagtgagtggcataagggcatccaggaggagatggaagcgctt
gtgaaggatcacggggtaaattccttcctcgtgtacatggctttcaaagatcgcttccag
ctaacggattgccagatttatgaagtactgagtgtgatccgggatattggcgccatagcc
caagtccacgcagaaaatggcgacatcattgcagaggagcagcagaggatcctggatctg
ggcatcacgggccccgagggacatgtgctgagccgacctgaggaggtcgaggccgaagcc
gtgaatcgtgccatcaccatcgccaaccagaccaactgcccgctgtatatcaccaaggtg
atgagcaaaagctctgctgaggtcatcgcccaggcacggaagaagggaactgtggtgtat
ggcgagcccatcactgccagcttgggaacggacggctcccattactggagcaagaactgg
gccaaggctgctgcctttgtcacctccccacccttgagccctgatccaaccactccagac
tttctcaactccttgctgtcctgtggagacctccaggtcacgggcagtgcccattgcacg
tttaacactgcccagaaggctgtaggaaaggacaacttcaccctgattccggagggcacc
aatggcactgaggagcggatgtccgtcatctgggacaaggctgtggtcactgggaagatg
gatgagaaccagtttgtggctgtgaccagcaccaatgcagccaaagtcttcaacctttac
ccccggaaaggccgcattgctgtgggatccgatgccgacctggtcatctgggaccccgac
agcgttaaaaccatctctgccaagacacacaacagctctctcgagtacaacatctttgaa
ggcatggagtgccgcggctccccactggtggtcatcagccaggggaagattgtcctggag
gacggcaccctgcatgtcaccgaaggctctggacgctacattccccggaagcccttccct
gattttgtttacaagcgtatcaaggcaaggagcaggctggctgagctgagaggggttcct
cgtggcctgtatgacggacctgtgtgtgaagtgtctgtgacgcccaagacagtcactcca
gcctcctcggccaagacgtctcctgccaagcagcaggccccacctgtccggaacctgcac
cagtctggattcagtttgtctggtgctcagattgatgacaacattccccgccgcaccacc
cagcgtatcgtggcgccccccggtggccgtgccaacatcaccagcctgggctag

DBGET integrated database retrieval system