KEGG   Homo sapiens (human): 181Help
Entry
181               CDS       T01001                                 

Gene name
AGRP, AGRT, ART, ASIP2
Definition
agouti related neuropeptide
Orthology
K05231  
agouti related protein
Organism
hsa  Homo sapiens (human)
Pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    181 (AGRP)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    181 (AGRP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22
AA seq 132 aa AA seqDB search
MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
KLGTAMNPCSRT
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgcagcggtgctgagctgtgccctgctgctggcactgcctgccacgcgagga
gcccagatgggcttggcccccatggagggcatcagaaggcctgaccaggccctgctccca
gagctcccaggcctgggcctgcgggccccactgaagaagacaactgcagaacaggcagaa
gaggatctgttgcaggaggctcaggccttggcagaggtactagacctgcaggaccgcgag
ccccgctcctcacgtcgctgcgtaaggctgcatgagtcctgcctgggacagcaggtgcct
tgctgtgacccatgtgccacgtgctactgccgcttcttcaatgccttctgctactgccgc
aagctgggtactgccatgaatccctgcagccgcacctag

DBGET integrated database retrieval system