KEGG   Homo sapiens (human): 181Help
Entry
181               CDS       T01001                                 

Gene name
AGRP, AGRT, ART, ASIP2
Definition
agouti related protein homolog (mouse)
Orthology
K05231  
agouti related protein
Organism
hsa  Homo sapiens (human)
Pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22
AA seq 132 aa AA seqDB search
MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
KLGTAMNPCSRT
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgcagcggtgctgagctgtgccctgctgctggcactgcctgccacgcgagga
gcccagatgggcttggcccccatggagggcatcagaaggcctgaccaggccctgctccca
gagctcccaggcctgggcctgcgggccccactgaagaagacaactgcagaacaggcagaa
gaggatctgttgcaggaggctcaggccttggcagaggtactagacctgcaggaccgcgag
ccccgctcctcacgtcgctgcgtaaggctgcatgagtcctgcctgggacagcaggtgcct
tgctgtgacccatgtgccacgtgctactgccgcttcttcaatgccttctgctactgccgc
aagctgggtactgccatgaatccctgcagccgcacctag

DBGET integrated database retrieval system