KEGG   Homo sapiens (human): 1812Help
Entry
1812              CDS       T01001                                 

Gene name
DRD1, DADR, DRD1A
Definition
(RefSeq) dopamine receptor D1
  KO
K04144  dopamine receptor D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04728  Dopaminergic synapse
hsa05012  Parkinson's disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
Drug target
Adrogolide hydrochloride: D02775
Apomorphine (DG00486): D02004 D07460
Butaclamol hydrochloride: D02641
Chlorprothixene (DG00894): D00790 D02162 D07686 D07687
Ciladopa hydrochloride: D03494
Clebopride (DG00059): D01742 D03534
Clopenthixol: D02613
Dexpramipexole (DG01331): D09886 D09887
Docarpamine: D01903
Dopamine (DG00213): D00633 D07870
Dopexamine (DG00222): D03891 D03892
Ecopipam hydrochloride: D03937
Fenoldopam (DG00226): D00613 D07946
Flupentixol (DG00893): D01044 D02236 D07976
Ibopamine (DG00223): D04488 D08057
Levodopa: D00059
Oxiperomide: D02676
Pergolide (DG00861): D00502 D08339
Tiotixene (DG00895): D00374 D02612
Zicronapine (DG01539): D10329 D10495
Zuclopenthixol (DG00896): D03556 D08691 D08692 D08693
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1812 (DRD1)
   04024 cAMP signaling pathway
    1812 (DRD1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1812 (DRD1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    1812 (DRD1)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1812 (DRD1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    1812 (DRD1)
  Substance dependence
   05030 Cocaine addiction
    1812 (DRD1)
   05031 Amphetamine addiction
    1812 (DRD1)
   05032 Morphine addiction
    1812 (DRD1)
   05034 Alcoholism
    1812 (DRD1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Dopamine [OT]
    1812 (DRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 1812
NCBI-ProteinID: NP_000785
OMIM: 126449
HGNC: 3020
Ensembl: ENSG00000184845
Vega: OTTHUMG00000130557
Pharos: P21728(Tclin)
UniProt: P21728
Position
5q35.2
AA seq 446 aa AA seqDB search
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggactctgaacacctctgccatggacgggactgggctggtggtggagagggacttc
tctgttcgtatcctcactgcctgtttcctgtcgctgctcatcctgtccacgctcctgggg
aacacgctggtctgtgctgccgttatcaggttccgacacctgcggtccaaggtgaccaac
ttctttgtcatctccttggctgtgtcagatctcttggtggccgtcctggtcatgccctgg
aaggcagtggctgagattgctggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccactgcatccatcctcaacctctgtgtgatcagcgtggac
aggtattgggctatctccagccctttccggtatgagagaaagatgacccccaaggcagcc
ttcatcctgatcagtgtggcatggaccttgtctgtactcatctccttcatcccagtgcag
ctcagctggcacaaggcaaaacccacaagcccctctgatggaaatgccacttccctggct
gagaccatagacaactgtgactccagcctcagcaggacatatgccatctcatcctctgta
ataagcttttacatccctgtggccatcatgattgtcacctacaccaggatctacaggatt
gctcagaaacaaatacggcgcattgcggccttggagagggcagcagtccacgccaagaat
tgccagaccaccacaggtaatggaaagcctgtcgaatgttctcaaccggaaagttctttt
aagatgtccttcaaaagagaaactaaagtcctgaagactctgtcggtgatcatgggtgtg
tttgtgtgctgttggctacctttcttcatcttgaactgcattttgcccttctgtgggtct
ggggagacgcagcccttctgcattgattccaacacctttgacgtgtttgtgtggtttggg
tgggctaattcatccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttcaaccctcttaggatgctacagactttgccctgcgacgaataatgccatagagacg
gtgagtatcaataacaatggggccgcgatgttttccagccatcatgagccacgaggctcc
atctccaaggagtgcaatctggtttacctgatcccacatgctgtgggctcctctgaggac
ctgaaaaaggaggaggcagctggcatcgccagacccttggagaagctgtccccagcccta
tcagtcatattggactatgacactgacgtctctctggagaagatccaacccatcacacaa
aacggtcagcacccaacctga

DBGET integrated database retrieval system