KEGG   Homo sapiens (human): 1815Help
Entry
1815              CDS       T01001                                 

Gene name
DRD4, D4DR
Definition
dopamine receptor D4
Orthology
K04147  
dopamine receptor D4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Dopaminergic synapse
Drug target
Dopamine: 
Dopexamine: 
Levodopa: 
Pramipexole: 
Clozapine: 
Olanzapine: 
Quetiapine: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 419 aa AA seqDB search
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG
LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT
PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgcagcaccgcggacgcggacgggctgctggctgggcgcgggccggccgcg
ggggcatctgcgggggcatctgcggggctggctgggcagggcgcggcggcgctggtgggg
ggcgtgctgctcatcggcgcggtgctcgcggggaactcgctcgtgtgcgtgagcgtggcc
accgagcgcgccctgcagacgcccaccaactccttcatcgtgagcctggcggccgccgac
ctcctcctcgctctcctggtgctgccgctcttcgtctactccgaggtccagggtggcgcg
tggctgctgagcccccgcctgtgcgacgccctcatggccatggacgtcatgctgtgcacc
gcctccatcttcaacctgtgcgccatcagcgtggacaggttcgtggccgtggccgtgccg
ctgcgctacaaccggcagggtgggagccgccggcagctgctgctcatcggcgccacgtgg
ctgctgtccgcggcggtggcggcgcccgtactgtgcggcctcaacgacgtgcgcggccgc
gaccccgccgtgtgccgcctggaggaccgcgactacgtggtctactcgtccgtgtgctcc
ttcttcctaccctgcccgctcatgctgctgctctactgggccacgttccgcggcctgcag
cgctgggaggtggcacgtcgcgccaagctgcacggccgcgcgccccgccgacccagcggc
cctggcccgccttcccccacgccacccgcgccccgcctcccccaggacccctgcggcccc
gactgtgcgccccccgcgcccggccttccccggggtccctgcggccccgactgtgcgccc
gccgcgcccagcctcccccaggacccctgcggccccgactgtgcgccccccgcgcccggc
ctccccccggacccctgcggctccaactgtgctccccccgacgccgtcagagccgccgcg
ctcccaccccagactccaccgcagacccgcaggaggcggcgtgccaagatcaccggccgg
gagcgcaaggccatgagggtcctgccggtggtggtcggggccttcctgctgtgctggacg
cccttcttcgtggtgcacatcacgcaggcgctgtgtcctgcctgctccgtgcccccgcgg
ctggtcagcgccgtcacctggctgggctacgtcaacagcgccctcaaccccgtcatctac
actgtcttcaacgccgagttccgcaacgtcttccgcaaggccctgcgtgcctgctgctga

DBGET integrated database retrieval system