KEGG   Homo sapiens (human): 1816Help
Entry
1816              CDS       T01001                                 

Gene name
DRD5, DBDR, DRD1B, DRD1L2
Definition
dopamine receptor D5
Orthology
K05840  
dopamine receptor D5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Dopaminergic synapse
Drug target
Dopamine: 
Dopexamine: 
Levodopa: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.1
AA seq 477 aa AA seqDB search
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgccaggcagcaacggcaccgcgtacccggggcagttcgctctataccagcag
ctggcgcaggggaacgccgtggggggctcggcgggggcaccgccactggggccctcacag
gtggtcaccgcctgcctgctgaccctactcatcatctggaccctgctgggcaacgtgctg
gtgtgcgcagccatcgtgcggagccgccacctgcgcgccaacatgaccaacgtcttcatc
gtgtctctggccgtgtcagaccttttcgtggcgctgctggtcatgccctggaaggcagtc
gccgaggtggccggttactggccctttggagcgttctgcgacgtctgggtggccttcgac
atcatgtgctccactgcctccatcctgaacctgtgcgtcatcagcgtggaccgctactgg
gccatctccaggcccttccgctacaagcgcaagatgactcagcgcatggccttggtcatg
gtcggcctggcatggaccttgtccatcctcatctccttcattccggtccagctcaactgg
cacagggaccaggcggcctcttggggcgggctggacctgccaaacaacctggccaactgg
acgccctgggaggaggacttttgggagcccgacgtgaatgcagagaactgtgactccagc
ctgaatcgaacctacgccatctcttcctcgctcatcagcttctacatccccgttgccatc
atgatcgtgacctacacgcgcatctaccgcatcgcccaggtgcagatccgcaggatttcc
tccctggagagggccgcagagcacgcgcagagctgccggagcagcgcagcctgcgcgccc
gacaccagcctgcgcgcttccatcaagaaggagaccaaggttctcaagaccctgtcggtg
atcatgggggtcttcgtgtgttgctggctgcccttcttcatccttaactgcatggtccct
ttctgcagtggacaccccgaaggccctccggccggcttcccctgcgtcagtgagaccacc
ttcgacgtcttcgtctggttcggctgggctaactcctcactcaaccccgtcatctatgcc
ttcaacgccgactttcagaaggtgtttgcccagctgctggggtgcagccacttctgctcc
cgcacgccggtggagacggtgaacatcagcaatgagctcatctcctacaaccaagacatc
gtcttccacaaggaaatcgcagctgcctacatccacatgatgcccaacgccgttaccccc
ggcaaccgggaggtggacaacgacgaggaggagggtcctttcgatcgcatgttccagatc
tatcagacgtccccagatggtgaccctgttgctgagtctgtctgggagctggactgcgag
ggggagatttctttagacaaaataacacctttcaccccgaatggattccattaa

DBGET integrated database retrieval system