KEGG   Homo sapiens (human): 1816Help
Entry
1816              CDS       T01001                                 

Gene name
DRD5, DBDR, DRD1B, DRD1L2
Definition
(RefSeq) dopamine receptor D5
  KO
K05840  dopamine receptor D5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04728  Dopaminergic synapse
Disease
H01895  Attention deficit hyperactivity disorder (ADHD)
Drug target
Dexpramipexole (DG01331): D09886 D09887
Dopamine (DG00213): D00633 D07870
Dopexamine (DG00222): D03891 D03892
Ecopipam hydrochloride: D03937
Levodopa: D00059
Oxiperomide: D02676
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1816 (DRD5)
   04024 cAMP signaling pathway
    1816 (DRD5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1816 (DRD5)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1816 (DRD5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Dopamine [OT]
    1816 (DRD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 1816
NCBI-ProteinID: NP_000789
OMIM: 126453
HGNC: 3026
Ensembl: ENSG00000169676
Vega: OTTHUMG00000128489
Pharos: P21918(Tchem)
UniProt: P21918
Position
4p16.1
AA seq 477 aa AA seqDB search
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgccaggcagcaacggcaccgcgtacccggggcagttcgctctataccagcag
ctggcgcaggggaacgccgtggggggctcggcgggggcaccgccactggggccctcacag
gtggtcaccgcctgcctgctgaccctactcatcatctggaccctgctgggcaacgtgctg
gtgtgcgcagccatcgtgcggagccgccacctgcgcgccaacatgaccaacgtcttcatc
gtgtctctggccgtgtcagaccttttcgtggcgctgctggtcatgccctggaaggcagtc
gccgaggtggccggttactggccctttggagcgttctgcgacgtctgggtggccttcgac
atcatgtgctccactgcctccatcctgaacctgtgcgtcatcagcgtggaccgctactgg
gccatctccaggcccttccgctacaagcgcaagatgactcagcgcatggccttggtcatg
gtcggcctggcatggaccttgtccatcctcatctccttcattccggtccagctcaactgg
cacagggaccaggcggcctcttggggcgggctggacctgccaaacaacctggccaactgg
acgccctgggaggaggacttttgggagcccgacgtgaatgcagagaactgtgactccagc
ctgaatcgaacctacgccatctcttcctcgctcatcagcttctacatccccgttgccatc
atgatcgtgacctacacgcgcatctaccgcatcgcccaggtgcagatccgcaggatttcc
tccctggagagggccgcagagcacgcgcagagctgccggagcagcgcagcctgcgcgccc
gacaccagcctgcgcgcttccatcaagaaggagaccaaggttctcaagaccctgtcggtg
atcatgggggtcttcgtgtgttgctggctgcccttcttcatccttaactgcatggtccct
ttctgcagtggacaccccgaaggccctccggccggcttcccctgcgtcagtgagaccacc
ttcgacgtcttcgtctggttcggctgggctaactcctcactcaaccccgtcatctatgcc
ttcaacgccgactttcagaaggtgtttgcccagctgctggggtgcagccacttctgctcc
cgcacgccggtggagacggtgaacatcagcaatgagctcatctcctacaaccaagacatc
gtcttccacaaggaaatcgcagctgcctacatccacatgatgcccaacgccgttaccccc
ggcaaccgggaggtggacaacgacgaggaggagggtcctttcgatcgcatgttccagatc
tatcagacgtccccagatggtgaccctgttgctgagtctgtctgggagctggactgcgag
ggggagatttctttagacaaaataacacctttcaccccgaatggattccattaa

DBGET integrated database retrieval system