KEGG   Homo sapiens (human): 182Help
Entry
182               CDS       T01001                                 

Gene name
JAG1, AGS, AGS1, AHD, AWS, CD339, HJ1, JAGL1
Definition
(RefSeq) jagged 1
  KO
K06052  jagged-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04371  Apelin signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04668  TNF signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00192  HPV E6 to host-cell-protein activation
Disease
H00549  Tetralogy of Fallot
H00551  Alagille syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    182 (JAG1)
   04371 Apelin signaling pathway
    182 (JAG1)
   04668 TNF signaling pathway
    182 (JAG1)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    182 (JAG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    182 (JAG1)
   05224 Breast cancer
    182 (JAG1)
  Infectious diseases
   05165 Human papillomavirus infection
    182 (JAG1)
  Drug resistance
   01522 Endocrine resistance
    182 (JAG1)
CD molecules [BR:hsa04090]
 Proteins
  182 (JAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3 MAP17 DUF2920
Motif
Other DBs
NCBI-GeneID: 182
NCBI-ProteinID: NP_000205
OMIM: 601920
HGNC: 6188
Ensembl: ENSG00000101384
Vega: OTTHUMG00000031872
Pharos: P78504(Tbio)
UniProt: P78504 Q99740
Structure
PDB: 

Jmol
Position
20p12.2
AA seq 1218 aa AA seqDB search
MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccccacggacgcgcggccggtccgggcgccccctaagcctcctgctcgccctg
ctctgtgccctgcgagccaaggtgtgtggggcctcgggtcagttcgagttggagatcctg
tccatgcagaacgtgaacggggagctgcagaacgggaactgctgcggcggcgcccggaac
ccgggagaccgcaagtgcacccgcgacgagtgtgacacatacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggccggggggccctgcagcttcggctcagggtccacgcct
gtcatcgggggcaacaccttcaacctcaaggccagccgcggcaacgaccgcaaccgcatc
gtgctgcctttcagtttcgcctggccgaggtcctatacgttgcttgtggaggcgtgggat
tccagtaatgacaccgttcaacctgacagtattattgaaaaggcttctcactcgggcatg
atcaaccccagccggcagtggcagacgctgaagcagaacacgggcgttgcccactttgag
tatcagatccgcgtgacctgtgatgactactactatggctttggctgcaataagttctgc
cgccccagagatgacttctttggacactatgcctgtgaccagaatggcaacaaaacttgc
atggaaggctggatgggccccgaatgtaacagagctatttgccgacaaggctgcagtcct
aagcatgggtcttgcaaactcccaggtgactgcaggtgccagtacggctggcaaggcctg
tactgtgataagtgcatcccacacccgggatgcgtccacggcatctgtaatgagccctgg
cagtgcctctgtgagaccaactggggcggccagctctgtgacaaagatctcaattactgt
gggactcatcagccgtgtctcaacgggggaacttgtagcaacacaggccctgacaaatat
cagtgttcctgccctgaggggtattcaggacccaactgtgaaattgctgagcacgcctgc
ctctctgatccctgtcacaacagaggcagctgtaaggagacctccctgggctttgagtgt
gagtgttccccaggctggaccggccccacatgctctacaaacattgatgactgttctcct
aataactgttcccacgggggcacctgccaggacctggttaacggatttaagtgtgtgtgc
cccccacagtggactgggaaaacgtgccagttagatgcaaatgaatgtgaggccaaacct
tgtgtaaacgccaaatcctgtaagaatctcattgccagctactactgcgactgtcttccc
ggctggatgggtcagaattgtgacataaatattaatgactgccttggccagtgtcagaat
gacgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgaatgtgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacatcgattattgtgagcctaatccctgccagaacggtgcccagtgc
tacaaccgtgccagtgactatttctgcaagtgccccgaggactatgagggcaagaactgc
tcacacctgaaagaccactgccgcacgaccccctgtgaagtgattgacagctgcacagtg
gccatggcttccaacgacacacctgaaggggtgcggtatatttcctccaacgtctgtggt
cctcacgggaagtgcaagagtcagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcacgggaacatactgccatgaaaatattaatgactgtgagagcaacccttgtagaaac
ggtggcacttgcatcgatggtgtcaactcctacaagtgcatctgtagtgacggctgggag
ggggcctactgtgaaaccaatattaatgactgcagccagaacccctgccacaatgggggc
acgtgtcgcgacctggtcaatgacttctactgtgactgtaaaaatgggtggaaaggaaag
acctgccactcacgtgacagtcagtgtgatgaggccacgtgcaacaacggtggcacctgc
tatgatgagggggatgcttttaagtgcatgtgtcctggcggctgggaaggaacaacctgt
aacatagcccgaaacagtagctgcctgcccaacccctgccataatgggggcacatgtgtg
gtcaacggcgagtcctttacgtgcgtctgcaaggaaggctgggaggggcccatctgtgct
cagaataccaatgactgcagccctcatccctgttacaacagcggcacctgtgtggatgga
gacaactggtaccggtgcgaatgtgccccgggttttgctgggcccgactgcagaataaac
atcaatgaatgccagtcttcaccttgtgcctttggagcgacctgtgtggatgagatcaat
ggctaccggtgtgtctgccctccagggcacagtggtgccaagtgccaggaagtttcaggg
agaccttgcatcaccatggggagtgtgataccagatggggccaaatgggatgatgactgt
aatacctgccagtgcctgaatggacggatcgcctgctcaaaggtctggtgtggccctcga
ccttgcctgctccacaaagggcacagcgagtgccccagcgggcagagctgcatccccatc
ctggacgaccagtgcttcgtccacccctgcactggtgtgggcgagtgtcggtcttccagt
ctccagccggtgaagacaaagtgcacctctgactcctattaccaggataactgtgcgaac
atcacatttacctttaacaaggagatgatgtcaccaggtcttactacggagcacatttgc
agtgaattgaggaatttgaatattttgaagaatgtttccgctgaatattcaatctacatc
gcttgcgagccttccccttcagcgaacaatgaaatacatgtggccatttctgctgaagat
atacgggatgatgggaacccgatcaaggaaatcactgacaaaataatcgatcttgttagt
aaacgtgatggaaacagctcgctgattgctgccgttgcagaagtaagagttcagaggcgg
cctctgaagaacagaacagatttccttgttcccttgctgagctctgtcttaactgtggct
tggatctgttgcttggtgacggccttctactggtgcctgcggaagcggcggaagccgggc
agccacacacactcagcctctgaggacaacaccaccaacaacgtgcgggagcagctgaac
cagatcaaaaaccccattgagaaacatggggccaacacggtccccatcaaggattatgag
aacaagaactccaaaatgtctaaaataaggacacacaattctgaagtagaagaggacgac
atggacaaacaccagcagaaagcccggtttgccaagcagccggcgtacacgctggtagac
agagaagagaagccccccaacggcacgccgacaaaacacccaaactggacaaacaaacag
gacaacagagacttggaaagtgcccagagcttaaaccgaatggagtacatcgtatag

DBGET integrated database retrieval system