KEGG   Homo sapiens (human): 1829Help
Entry
1829              CDS       T01001                                 

Gene name
DSG2, ARVC10, ARVD10, CDHF5, CMD1BB, HDGC
Definition
desmoglein 2
Orthology
K07597  
desmoglein 2
Organism
hsa  Homo sapiens (human)
Pathway
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H00293  
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1829 (DSG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q12.1
AA seq 1118 aa AA seqDB search
MARSPGRAYALLLLLICFNVGSGLHLQVLSTRNENKLLPKHPHLVRQKRAWITAPVALRE
GEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDRE
ETPFFLLTGYALDARGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMK
INATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVE
ARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADE
IGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVANKAAF
HKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDT
GLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKT
ITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGM
AEKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCR
EAQHDSYVGLGPAAIALMILAFLLLLLVPLLLLMCHCGKGAKGFTPIPGTIEMLHPWNNE
GAPPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEE
HRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKA
ASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC
LGQKIDINKEIEQRQKPATETSMNTASHSLCEQTMVNSENTYSSGSSFPVPKSLQEANAE
KVTQEIVTERSVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTMPPTTVILGPSQPQS
LIVTERVYAPASTLVDQPYANEGTVVVTERVIQPHGGGSNPLEGTQHLQDVPYVMVRERE
SFLAPSSGVQPTLAMPNIAVGQNVTVTERVLAPASTLQSSYQIPTENSMTARNTTVSGAG
VPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggagcccgggacgcgcgtacgccctgctgcttctcctgatctgctttaacgtt
ggaagtggacttcacttacaggtcttaagcacaagaaatgaaaataagctgcttcctaaa
catcctcatttagtgcggcaaaagcgcgcctggatcaccgcccccgtggctcttcgggag
ggagaggatctgtccaagaagaatccaattgccaagatacattctgatcttgcagaagaa
agaggactcaaaattacttacaaatacactggaaaagggattacagagccaccttttggt
atatttgtctttaacaaagatactggagaactgaatgttaccagcattcttgatcgagaa
gaaacaccattttttctgctaacaggttacgctttggatgcaagaggaaacaatgtagag
aaacccttagagctacgcattaaggttcttgatatcaatgacaacgaaccagtgttcaca
caggatgtctttgttgggtctgttgaagagttgagtgcagcacatactcttgtgatgaaa
atcaatgcaacagatgcagatgagcccaataccctgaattcgaaaatttcctatagaatc
gtatctctggagcctgcttatcctccagtgttctacctaaataaagatacaggagagatt
tatacaaccagtgttaccttggacagagaggaacacagcagctacactttgacagtagaa
gcaagagatggcaatggagaagttacagacaaacctgtaaaacaagctcaagttcagatt
cgtattttggatgtcaatgacaatatacctgtagtagaaaataaagtgcttgaagggatg
gttgaagaaaatcaagtcaacgtagaagttacgcgcataaaagtgttcgatgcagatgaa
ataggttctgataattggctggcaaattttacatttgcatcaggaaatgaaggaggttat
ttccacatagaaacagatgctcaaactaacgaaggaattgtgacccttattaaggaagta
gattatgaagaaatgaagaatcttgacttcagtgttattgtcgctaataaagcagctttt
cacaagtcgattaggagtaaatacaagcctacacccattcccatcaaggtcaaagtgaaa
aatgtgaaagaaggcattcattttaaaagcagcgtcatctcaatttatgttagcgagagc
atggatagatcaagcaaaggccaaataattggaaattttcaagcttttgatgaggacact
ggactaccagcccatgcaagatatgtaaaattagaagatagagataattggatctctgtg
gattctgtcacatctgaaattaaacttgcaaaacttcctgattttgaatctagatatgtt
caaaatggcacatacactgtaaagattgtggccatatcagaagattatcctagaaaaacc
atcactggcacagtccttatcaatgttgaagacatcaacgacaactgtcccacactgata
gagcctgtgcagacaatctgtcacgatgcagagtatgtgaatgttactgcagaggacctg
gatggacacccaaacagtggccctttcagtttctccgtcattgacaaaccacctggcatg
gcagaaaaatggaaaatagcacgccaagaaagtaccagtgtgctgctgcaacaaagtgag
aaaaagcttgggagaagtgaaattcagttcctgatttcagacaatcagggttttagttgt
cctgaaaagcaggtccttacactcacagtttgtgagtgtctgcatggcagcggctgcagg
gaagcacagcatgactcctatgtgggcctgggacccgcagcaattgcgctcatgattttg
gcctttctgctcctgctattggtaccacttttactgctgatgtgccattgcggaaagggc
gccaaaggctttacccccatacctggcaccatagagatgctgcatccttggaataatgaa
ggagcaccacctgaagacaaggtggtgccatcatttctgccagtggatcaagggggcagt
ctagtaggaagaaatggagtaggaggtatggccaaggaagccacgatgaaaggaagtagc
tctgcttccattgtcaaagggcaacatgagatgtccgagatggatggaaggtgggaagaa
cacagaagcctgctttctggtagagctacccagtttacaggggccacaggcgctatcatg
accactgaaaccacgaagaccgcaagggccacaggggcttccagagacatggccggagct
caggcagctgctgttgcactgaacgaagaattcttaagaaattatttcactgataaagcg
gcctcttacactgaggaagatgaaaatcacacagccaaagattgccttctggtttattct
caggaagaaactgaatcgctgaatgcttctattggttgttgcagttttattgaaggagag
ctagatgaccgcttcttagatgatttgggacttaaattcaagacactagctgaagtttgc
ctgggtcaaaaaatagatataaataaggaaattgagcagagacaaaaacctgccacagaa
acaagtatgaacacagcttcacattcactctgtgagcaaactatggttaattcagagaat
acctactcctctggcagtagcttcccagttccaaaatctttgcaagaagccaatgcagag
aaagtaactcaggaaatagtcactgaaagatctgtgtcttctaggcaggcgcaaaaggta
gctacacctcttcctgacccaatggcttctagaaatgtgatagcaacagaaacttcctat
gtcacagggtccactatgccaccaaccactgtgatcctgggtcctagccagccacagagc
cttattgtgacagagagggtgtatgctccagcttctaccttggtagatcagccttatgct
aatgaaggtacagttgtggtcactgaaagagtaatacagcctcatgggggtggatcgaat
cctctggaaggcactcagcatcttcaagatgtaccttacgtcatggtgagggaaagagag
agcttccttgcccccagctcaggtgtgcagcctactctggccatgcctaatatagcagta
ggacagaatgtgacagtgacagaaagagttctagcacctgcttccactctgcaatccagt
taccagattcccactgaaaattctatgacggctaggaacaccacggtgtctggagctgga
gtccctggccctctgccagattttggtttagaggaatctggtcattctaattctaccata
accacatcttccaccagagttaccaagcatagcactgtacagcattcttactcctaa

DBGET integrated database retrieval system