KEGG   Homo sapiens (human): 1832Help
Entry
1832              CDS       T01001                                 

Gene name
DSP, DCWHKTA, DP
Definition
(RefSeq) desmoplakin
  KO
K10381  
desmoplakin
Organism
hsa  Homo sapiens (human)
Pathway
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H00293  
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
H00584  
Epidermolysis bullosa simplex
H00669  
Naxos disease and Carvajal syndrome
H00717  
Striate palmoplantar keratoderma
H00893  
Skin fragility-woolly hair syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1832 (DSP)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    1832 (DSP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1832 (DSP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p24
AA seq 2871 aa AA seqDB search
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTG
TMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEI
LDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKA
DLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
KNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKE
LEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGD
ECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMF
GDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRE
NDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIA
EVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQT
EDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHS
QTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCK
WLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKD
YELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEM
LKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLE
ELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYD
QLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYN
EEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSI
LQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTI
QDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQL
TMQKEEDTSGYRAQIDNLTRENRSLSEEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEV
SQRKQQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCL
EDENARLQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQ
NSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLE
QASIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHL
RNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSE
ADSDKNATILELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQE
SKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQI
QNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDS
TRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQL
YECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLI
SPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPF
SGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYR
SLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVT
ELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKI
GLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYN
DPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEE
LSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNT
LRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLV
DRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSSMGSGVSDD
VFSSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERG
IVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEG
VKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRA
AQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMS
SAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH
NT seq 8616 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaacggaggctcccacccgcggatcaacactctgggccgcatgatccgcgcc
gagtctggcccggacctgcgctacgaggtgaccagcggcggcgggggcaccagcaggatg
tactattctcggcgcggcgtgatcaccgaccagaactcggacggctactgtcaaaccggc
acgatgtccaggcaccagaaccagaacaccatccaggagctgctgcagaactgctccgac
tgcttgatgcgagcagagctcatcgtgcagcctgaattgaagtatggagatggaatacaa
ctgactcggagtcgagaattggatgagtgttttgcccaggccaatgaccaaatggaaatc
ctcgacagcttgatcagagagatgcggcagatgggccagccctgtgatgcttaccagaaa
aggcttcttcagctccaagagcaaatgcgagccctttataaagccatcagtgtccctcga
gtccgcagggccagctccaagggtggtggaggctacacttgtcagagtggctctggctgg
gatgagttcaccaaacatgtcaccagtgaatgtttggggtggatgaggcagcaaagggcg
gagatggacatggtggcctggggtgtggacctggcctcagtggagcagcacattaacagc
caccggggcatccacaactccatcggcgactatcgctggcagctggacaaaatcaaagcc
gacctgcgcgagaaatctgcgatctaccagttggaggaggagtatgaaaacctgctgaaa
gcgtcctttgagaggatggatcacctgcgacagctgcagaacatcattcaggccacgtcc
agggagatcatgtggatcaatgactgcgaggaggaggagctgctgtacgactggagcgac
aagaacaccaacatcgctcagaaacaggaggccttctccatacgcatgagtcaactggaa
gttaaagaaaaagagctcaataagctgaaacaagaaagtgaccaacttgtcctcaatcag
catccagcttcagacaaaattgaggcctatatggacactctgcagacgcagtggagttgg
attcttcagatcaccaagtgcattgatgttcatctgaaagaaaatgctgcctactttcag
ttttttgaagaggcgcagtctactgaagcatacctgaaggggctccaggactccatcagg
aagaagtacccctgcgacaagaacatgcccctgcagcacctgctggaacagatcaaggag
ctggagaaagaacgagagaaaatccttgaatacaagcgtcaggtgcagaacttggtaaac
aagtctaagaagattgtacagctgaagcctcgtaacccagactacagaagcaataaaccc
attattctcagagctctctgtgactacaaacaagatcagaaaatcgtgcataagggggat
gagtgtatcctgaaggacaacaacgagcgcagcaagtggtacgtgacgggcccgggaggc
gttgacatgcttgttccctctgtggggctgatcatccctcctccgaacccactggccgtg
gacctctcttgcaagattgagcagtactacgaagccatcttggctctgtggaaccagctc
tacatcaacatgaagagcctggtgtcctggcactactgcatgattgacatagagaagatc
agggccatgacaatcgccaagctgaaaacaatgcggcaggaagattacatgaagacgata
gccgaccttgagttacattaccaagagttcatcagaaatagccaaggctcagagatgttt
ggagatgatgacaagcggaaaatacagtctcagttcaccgatgcccagaagcattaccag
accctggtcattcagctccctggctatccccagcaccagacagtgaccacaactgaaatc
actcatcatggaacctgccaagatgtcaaccataataaagtaattgaaaccaacagagaa
aatgacaagcaagaaacatggatgctgatggagctgcagaagattcgcaggcagatagag
cactgcgagggcaggatgactctcaaaaacctccctctagcagaccagggatcttctcac
cacatcacagtgaaaattaacgagcttaagagtgtgcagaatgattcacaagcaattgct
gaggttctcaaccagcttaaagatatgcttgccaacttcagaggttctgaaaagtactgc
tatttacagaatgaagtatttggactatttcagaaactggaaaatatcaatggtgttaca
gatggctacttaaatagcttatgcacagtaagggcactgctccaggctattctccaaaca
gaagacatgttaaaggtttatgaagccaggctcactgaggaggaaactgtctgcctggac
ctggataaagtggaagcttaccgctgtggactgaagaaaataaaaaatgacttgaacttg
aagaagtcgttgttggccactatgaagacagaactacagaaagcccagcagatccactct
cagacttcacagcagtatccactttatgatctggacttgggcaagttcggtgaaaaagtc
acacagctgacagaccgctggcaaaggatagataaacagatcgactttaggttatgggac
ctggagaaacaaatcaagcaattgaggaattatcgtgataactatcaggctttctgcaag
tggctctatgatgctaaacgccgccaggattccttagaatccatgaaatttggagattcc
aacacagtcatgcggtttttgaatgagcagaagaacttgcacagtgaaatatctggcaaa
cgagacaaatcagaggaagtacaaaaaattgctgaactttgcgccaattcaattaaggat
tatgagctccagctggcctcatacacctcaggactggaaactctgctgaacatacctatc
aagaggaccatgattcagtccccttctggggtgattctgcaagaggctgcagatgttcat
gctcggtacattgaactacttacaagatctggagactattacaggttcttaagtgagatg
ctgaagagtttggaagatctgaagctgaaaaataccaagatcgaagttttggaagaggag
ctcagactggcccgagatgccaactcggaaaactgtaataagaacaaattcctggatcag
aacctgcagaaataccaggcagagtgttcccagttcaaagcgaagcttgcgagcctggag
gagctgaagagacaggctgagctggatgggaagtcggctaagcaaaatctagacaagtgc
tacggccaaataaaagaactcaatgagaagatcacccgactgacttatgagattgaagat
gaaaagagaagaagaaaatctgtggaagacagatttgaccaacagaagaatgactatgac
caactgcagaaagcaaggcaatgtgaaaaggagaaccttggttggcagaaattagagtct
gagaaagccatcaaggagaaggagtacgagattgaaaggttgagggttctactgcaggaa
gaaggcacccggaagagagaatatgaaaatgagctggcaaaggtaagaaaccactataat
gaggagatgagtaatttaaggaacaagtatgaaacagagattaacattacgaagaccacc
atcaaggagatatccatgcaaaaagaggatgattccaaaaatcttagaaaccagcttgat
agactttcaagggaaaatcgagatctgaaggatgaaattgtcaggctcaatgacagcatc
ttgcaggccactgagcagcgaaggcgagctgaagaaaacgcccttcagcaaaaggcctgt
ggctctgagataatgcagaagaagcagcatctggagatagaactgaagcaggtcatgcag
cagcgctctgaggacaatgcccggcacaagcagtccctggaggaggctgccaagaccatt
caggacaaaaataaggagatcgagagactcaaagctgagtttcaggaggaggccaagcgc
cgctgggaatatgaaaatgaactgagtaaggtaagaaacaattatgatgaggagatcatt
agcttaaaaaatcagtttgagaccgagatcaacatcaccaagaccaccatccaccagctc
accatgcagaaggaagaggataccagtggctaccgggctcagatagacaatctcacccga
gaaaacaggagcttatctgaagaaataaagaggctgaagaacactctaacccagaccaca
gagaatctcaggagggtggaagaagacatccaacagcaaaaggccactggctctgaggtg
tctcagaggaaacagcagctggaggttgagctgagacaagtcactcagatgcgaacagag
gagagcgtaagatataagcaatctcttgatgatgctgccaaaaccatccaggataaaaac
aaggagatagaaaggttaaaacaactgatcgacaaagaaacaaatgaccggaaatgcctg
gaagatgaaaacgcgagattacaaagggtccagtatgacctgcagaaagcaaacagtagt
gcgacggagacaataaacaaactgaaggttcaggagcaagaactgacacgcctgaggatc
gactatgaaagggtttcccaggagaggactgtgaaggaccaggatatcacgcggttccag
aactctctgaaagagctgcagctgcagaagcagaaggtggaagaggagctgaatcggctg
aagaggaccgcgtcagaagactcctgcaagaggaagaagctggaggaagagctggaaggc
atgaggaggtcgctgaaggagcaagccatcaaaatcaccaacctgacccagcagctggag
caggcatccattgttaagaagaggagtgaggatgacctccggcagcagagggacgtgctg
gatggccacctgagggaaaagcagaggacccaggaagagctgaggaggctctcttctgag
gtcgaggccctgaggcggcagttactccaggaacaggaaagtgtcaaacaagctcacttg
aggaatgagcatttccagaaggcgatagaagataaaagcagaagcttaaatgaaagcaaa
atagaaattgagaggctgcagtctctcacagagaacctgaccaaggagcacttgatgtta
gaagaagaactgcggaacctgaggctggagtacgatgacctgaggagaggacgaagcgaa
gcggacagtgataaaaatgcaaccatcttggaactaaggagccagctgcagatcagcaac
aaccggaccctggaactgcaggggctgattaatgatttacagagagagagggaaaatttg
agacaggaaattgagaaattccaaaagcaggctttagaggcatctaataggattcaggaa
tcaaagaatcagtgtactcaggtggtacaggaaagagagagccttctggtgaaaatcaaa
gtcctggagcaagacaaggcaaggctgcagaggctggaggatgagctgaatcgtgcaaaa
tcaactctagaggcagaaaccagggtgaaacagcgcctggagtgtgagaaacagcaaatt
cagaatgacctgaatcagtggaagactcaatattcccgcaaggaggaggctattaggaag
atagaatcggaaagagaaaagagtgagagagagaagaacagtcttaggagtgagatcgaa
agactccaagcagagatcaagagaattgaagagaggtgcaggcgtaagctggaggattct
accagggagacacagtcacagttagaaacagaacgctcccgatatcagagggagattgat
aaactcagacagcgcccatatgggtcccatcgagagacccagactgagtgtgagtggacc
gttgacacctccaagctggtgtttgatgggctgaggaagaaggtgacagcaatgcagctc
tatgagtgtcagctgatcgacaaaacaaccttggacaaactattgaaggggaagaagtca
gtggaagaagttgcttctgaaatccagccattccttcggggtgcaggatctatcgctgga
gcatctgcttctcctaaggaaaaatactctttggtagaggccaagagaaagaaattaatc
agcccagaatccacagtcatgcttctggaggcccaggcagctacaggtggtataattgat
ccccatcggaatgagaagctgactgtcgacagtgccatagctcgggacctcattgacttc
gatgaccgtcagcagatatatgcagcagaaaaagctatcactggttttgatgatccattt
tcaggcaagacagtatctgtttcagaagccatcaagaaaaatttgattgatagagaaacc
ggaatgcgcctgctggaagcccagattgcttcagggggtgtagtagaccctgtgaacagt
gtctttttgccaaaagatgtcgccttggcccgggggctgattgatagagatttgtatcga
tccctgaatgatccccgagatagtcagaaaaactttgtggatccagtcaccaaaaagaag
gtcagttacgtgcagctgaaggaacggtgcagaatcgaaccacatactggtctgctcttg
ctttcagtacagaagagaagcatgtccttccaaggaatcagacaacctgtgaccgtcact
gagctagtagattctggtatattgagaccgtccactgtcaatgaactggaatctggtcag
atttcttatgacgaggttggtgagagaattaaggacttcctccagggttcaagctgcata
gcaggcatatacaatgagaccacaaaacagaagcttggcatttatgaggccatgaaaatt
ggcttagtccgacctggtactgctctggagttgctggaagcccaagcagctactggcttt
atagtggatcctgttagcaacttgaggttaccagtggaggaagcctacaagagaggtctg
gtgggcattgagttcaaagagaagctcctgtctgcagaacgagctgtcactgggtataat
gatcctgaaacaggaaacatcatctctttgttccaagccatgaataaggaactcatcgaa
aagggccacggtattcgcttattagaagcacagatcgcaaccggggggatcattgaccca
aaggagagccatcgtttaccagttgacatagcatataagaggggctatttcaatgaggaa
ctcagtgagattctctcagatccaagtgatgataccaaaggattttttgaccccaacact
gaagaaaatcttacctatctgcaactaaaagaaagatgcattaaggatgaggaaacaggg
ctctgtcttctgcctctgaaagaaaagaagaaacaggtgcagacatcacaaaagaatacc
ctcaggaagcgtagagtggtcatagttgacccagaaaccaataaagaaatgtctgttcag
gaggcctacaagaagggcctaattgattatgaaaccttcaaagaactgtgtgagcaggaa
tgtgaatgggaagaaataaccatcacgggatcagatggctccaccagggtggtcctggta
gatagaaagacaggcagtcagtatgatattcaagatgctattgacaagggccttgttgac
aggaagttctttgatcagtaccgatccggcagcctcagcctcactcaatttgctgacatg
atctccttgaaaaatggtgtcggcaccagcagcagcatgggcagtggtgtcagcgatgat
gtttttagcagctcccgacatgaatcagtaagtaagatttccaccatatccagcgtcagg
aatttaaccataaggagcagctctttttcagacaccctggaagaatcgagccccattgca
gccatctttgacacagaaaacctggagaaaatctccattacagaaggtatagagcggggc
atcgttgacagcatcacgggtcagaggcttctggaggctcaggcctgcacaggtggcatc
atccacccaaccacgggccagaagctgtcacttcaggacgcagtctcccagggtgtgatt
gaccaagacatggccaccaggctgaagcctgctcagaaagccttcataggcttcgagggt
gtgaagggaaagaagaagatgtcagcagcagaggcagtgaaagaaaaatggctcccgtat
gaggctggccagcgcttcctggagttccagtacctcacgggaggtcttgttgacccggaa
gtgcatgggaggataagcaccgaagaagccatccggaaggggttcatagatggccgcgcc
gcacagaggctgcaagacaccagcagctatgccaaaatcctgacctgccccaaaaccaaa
ttaaaaatatcctataaggatgccataaatcgctccatggtagaagatatcactgggctg
cgccttctggaagccgcctccgtgtcgtccaagggcttacccagcccttacaacatgtct
tcggctccggggtcccgctccggctcccgctcgggatctcgctccggatctcgctccggg
tcccgcagtgggtcccggagaggaagctttgacgccacagggaattcttcctactcttat
tcctactcatttagcagtagttctattgggcactag

DBGET integrated database retrieval system