KEGG   Homo sapiens (human): 1837Help
Entry
1837              CDS       T01001                                 

Gene name
DTNA, D18S892E, DRP3, DTN, DTN-A, LVNC1
Definition
(RefSeq) dystrobrevin alpha
Organism
hsa  Homo sapiens (human)
Disease
H01216  
Left ventricular noncompaction (LVNC)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q12
AA seq 743 aa AA seqDB search
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLFSHSVPSSGSP
FITRSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNP
SCMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELE
NKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRR
ELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGVGGD
VQEAFAQSSRRNLRNDLLVAADSITNTMSSLVKELNSEVGSETESNVDSEFARTQFEDLV
PSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDADPYVQPEDENYENDSVRQLEN
ELQMEEYLKQKLQDEAYQVSLQG
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagatagtgggaaaagaggaaataccatggcagaaagaagacagctgtttgca
gagatgagggctcaagatctggatcgcatccgactctccacctacagaacagcatgcaag
cttaggtttgttcagaagaaatgcaatttgcacctggtggacatatggaatgtcatagaa
gcattgcgggaaaatgctctgaacaacctggacccaaacactgaactcaacgtgtcccgc
ttagaggctgtgctctccactattttttaccagctcaacaaacggatgccaaccactcac
caaatccatgtggagcagtccatcagcctcctccttaacttcctgcttgcagcgtttgat
ccggaaggccatggtaaaatttcagtatttgctgtcaaaatggctttagccacattgtgt
ggagggaagatcatggacaaattaagatatattttctcaatgatttctgactccagtggg
gtgatggtttatggacgatatgaccaattccttcgggaagttctcaaactacccacggca
gtttttgaaggtccttcatttggttacacagaacagtcagccagatcctgtttctcccaa
cagaaaaaagtcacgttaaatggtttcttggacacgcttatgtcagatcctcccccgcag
tgtctggtctggttgcctcttctgcatcgactagcaaatgtggaaaatgtcttccatccg
gttgagtgttcctactgccacagtgagagtatgatgggatttcgctaccgatgccaacag
tgtcacaattaccagctctgtcaggactgcttctggaggggacatgccggtggttctcat
agcaaccagcaccaaatgaaagagtacacgtcatggaaatcacctgctaagaagctgact
aatgcattaagcaagtccctgagctgtgcttccagccgtgaacctttgcaccccatgttc
ccagatcagcctgagaagccactcaacttggctcacatcgttgatacttggcctcccaga
cctgtaaccagcatgaacgacaccctgttctcccactctgttccctcctcaggaagtcct
tttattaccaggagctctcctcccaaggacagtgaagtagagcagaacaaactgctggct
agggctgctccagcttttctgaagggcaaagggatacagtacagcctgaatgtggcagac
aggctagctgatgaacatgttctcatcgggttgtatgtcaacatgctccggaacaacccc
tcatgcatgcttgagagttcaaaccggcttgatgaagaacacaggctaattgccaggtat
gcggcaaggctggcagcagagtcctcttcgtctcagccacctcagcagagaagtgctcct
gacatctctttcaccatcgatgcgaataagcagcaaaggcagctgattgctgagctagaa
aacaagaacagagaaatcttacaggagatccagagacttcggctagagcatgaacaagct
tctcagcccacgccagagaaggcacagcaaaaccccaccctgctggcagaactccggctc
ctcagacagcgcaaagatgagctggaacagagaatgtctgctctccaggagagccggaga
gagctaatggtccagttggagggtctcatgaagctactaaagactcagggggcaggctct
ccccgctcctcccccagccacaccatcagcaggccaattcccatgcccatccggtcagcg
tcagcctgctccaccccgacgcacacgccgcaggactccctcacaggagtagggggagat
gtacaagaggcatttgcacaaagttcaagaagaaacttaaggaatgacttgctagtggct
gcagattccatcactaacactatgtcctctcttgtgaaagagctgaattctgaggttggg
agtgaaacagagagtaatgtggattctgaatttgcacggactcagtttgaggatcttgtt
ccctcaccaacctctgaaaaggcttttctagcgcaaatccatgcccgaaaacctgggtac
attcacagtggagctaccacaagtaccatgcgtggcgacatggttacggaggatgcagat
ccctatgtgcagcctgaagatgaaaactatgaaaatgactctgtccggcagctggagaat
gagctccagatggaggaatacctgaaacagaagctgcaagatgaagcttatcaggtcagc
ttgcaaggttga

DBGET integrated database retrieval system