KEGG   Homo sapiens (human): 1840Help
Entry
1840              CDS       T01001                                 

Gene name
DTX1, hDx-1
Definition
deltex 1, E3 ubiquitin ligase
Orthology
K06058  
deltex
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    1840 (DTX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.13
AA seq 620 aa AA seqDB search
MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTA
YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLT
VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPPAPPLPPPPPPGG
PPGALAVRPSATFTGAALWAAPAAGPAEPAPPPGAPPRSPGAPGGARTPGQNNLNRPGPQ
RTTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHP
PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVT
ASGYEGVLRHKGVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTG
TQPPGKMEFHLIPHSLPGFPDTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPN
NEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASY
LDNVLAELTAQGVSEAAAKA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggccaggccacggtgggctgatgcctgtgaatggtctgggcttcccaccgcag
aacgtggcccgggtggtggtgtgggagtggctgaatgagcacagccgctggcggccctac
acggccaccgtgtgccaccacattgagaacgtgctgaaggaggacgctcgcggttccgtg
gtcctggggcaggtggacgcccagcttgtgccctacatcatcgacctgcagtccatgcac
cagtttcgccaggacacaggcaccatgcggcccgtgcggcgcaacttctacgacccgtcg
tcggcgccgggcaagggcatcgtgtgggagtgggagaacgacggcggcgcatggacggcc
tacgatatggacatctgcatcaccatccagaacgcctacgagaagcagcacccgtggctc
gacctctcatcgctaggcttctgctacctcatctacttcaacagcatgtcgcagatgaac
cgccagacgcgccggcgccgccgcctgcgccgccgcctggacctcgcctacccgctcacc
gtgggctccatccctaagtcgcagtcgtggcccgtgggcgccagctcgggccagccctgc
tcctgccagcagtgcctgctggtcaacagcacgcgcgccgcctccaacgccatcctggcc
tcgcagcgccgcaaggcgccccccgcgcccccgctgccgccgccgccgccacctggaggg
cctccaggcgcgcttgccgtgcgccccagcgccaccttcacaggcgccgcgctctgggca
gcgcccgccgccggccccgccgagcccgcgccgcctcccggggcgcccccacggagcccg
ggcgcccccggcggagcgcgcaccccggggcagaacaacctcaaccggcccgggccccag
cgcaccaccagcgtgagcgcgcgcgcctccatcccgccgggggtccccgcactcccggtg
aagaacttgaatggtactgggccggtccatccggccctggcagggatgaccgggatactg
ctgtgcgcggccgggctgcccgtgtgcctgacgcgggcccccaagcccatcctgcacccg
ccgcccgtgagcaagagcgacgtgaagcccgtgcctggcgtgcccggggtgtgccgcaag
accaagaagaagcaccttaaaaagagtaagaatcccgaggatgtggttcgaagatacatg
cagaaggtgaaaaacccacctgatgaggactgcaccatctgcatggagcgactggtcaca
gcatcaggctacgagggcgtgcttcggcacaagggcgtgcggcctgagctcgtgggccgc
ctgggccgctgtggccacatgtaccacctgctgtgcctcgtggccatgtactccaatggc
aacaaggatggcagcctgcagtgccccacctgcaaggccatctacggggagaagacgggt
acgcagccgcctgggaagatggagttccacctcatcccccactcgctgcccggcttccct
gatacccagaccatccgcatcgtctatgacatccccacaggcatccagggccctgagcac
cccaaccccgggaagaagttcaccgcaagaggattccctcgccactgctatctacccaac
aacgagaaaggccggaaggtgctgcggctgctcatcacggcctgggagagaagactcatc
ttcactatcggcacgtccaacaccacgggcgagtcggacaccgtggtgtggaacgagatc
caccacaagaccgagtttggatccaacctcacgggccacggctacccggacgctagctac
ctagacaacgtgctggctgagctcacagcccagggcgtatccgaggctgcagccaaggct
tga

DBGET integrated database retrieval system