KEGG   Homo sapiens (human): 1842Help
Entry
1842              CDS       T01001                                 

Gene name
ECM2
Definition
(RefSeq) extracellular matrix protein 2
  KO
K08119  
extracellular matrix protein 2
Organism
hsa  Homo sapiens (human)
Brite
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    1842 (ECM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O94769(Tdark)
UniProt: 
Position
9q22.31
AA seq 699 aa AA seqDB search
MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTV
FTPVARLPIVNFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEP
CTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGD
SSEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEEDTEQKRETPESRNQGQLY
SEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGEEGEEDEEDEEDPVRGDMFRM
PSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPD
EAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELK
VNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIP
QGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESI
DLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDR
VSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDDDS
NLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagttttgttttgtttttttctgcttatcatttttcaaactgactttgga
aaaaatgaagaaattcctaggaagcaaaggaggaagatctaccacagaaggttgaggaaa
agttcaacctcacacaagcacagatcaaacagacagcttggaattcagcaaacaacagtt
tttacaccagtagcaagacttcctattgttaactttgattatagcatggaggaaaagttt
gaatccttttcaagttttcctggagtagaatcaagttataatgtgttaccaggaaagaag
ggacactgtttggtaaagggcataaccatgtacaacaaagctgtgtggtcgcctgagccc
tgcactacctgcctctgctcagatggaagagttctttgtgatgaaaccatgtgccatccc
cagaggtgcccccaaacagttatacctgaaggggaatgctgcccggtctgctccgctact
gtctcctattctctactcagtggtatagcattaaatgatagaaatgaattttctggtgat
tcttcagaacaaagagaacctaccaatttacttcataagcaactgccacctcctcaggtg
ggaatggaccgaatagtaagaaaagaagcacttcaatctgaggaggatgaagaagtgaaa
gaagaagatacagagcaaaagagagagacccctgaatctagaaatcaggggcaactttac
agtgagggggacagcagaggaggagacagaaagcagaggcctggagaggagaggaggctg
gcacaccagcaacaacgccaaggaagggaggaggaggaggatgaggaggaggagggtgag
gagggtgaggaggatgaggaggacgaggaggacccggtaagaggagatatgttccgaatg
ccctctcgatccccgcttcctgctcctcccagaggcacactgcgcctgccaagcgggtgc
tctctgtcctacaggaccatcagctgcatcaacgccatgcttacccagataccaccgctg
acagcaccacagataacaagtctggagctcactggcaattccatcgcctccatcccagat
gaagcatttaatggattaccaaatttggaaaggcttgatctgagtaaaaataatatcact
tcttcaggcataggtccaaaagcattcaagcttctgaagaagttaatgcgtttgaatatg
gatggaaataatttgatacagattccttcacaattgccatctacattagaagaacttaaa
gtcaatgagaacaatcttcaggctatcgatgaagaaagtttatcagacttaaatcagttg
gtcaccttagaattggaaggaaacaatctcagtgaagccaatgtcaatcctttagctttc
aaacctttgaagagcctagcctacttgcgtctgggaaaaaataaatttagaattataccg
cagggtcttcctggttctattgaggaattatacctagaaaataaccaaattgaagaaata
actgaaatttgtttcaatcataccagaaagatcaatgtcattgtactacgttataacaaa
attgaagaaaataggattgctcctttagcctggataaatcaagaaaatctagaatccatt
gatctctcctacaacaagctctatcacgtcccgtcctatctacccaagtccttgctgcac
ctagtactccttgggaaccagattgaacggatccctggctatgtgtttggccacatggaa
ccaggcctggaatacttgtacctgtcatttaacaaacttgctgatgatggcatggaccgt
gtctccttctatggggcatatcattctctgagagaattatttctggatcacaatgactta
aaatctataccacctgggatacaagaaatgaaagcactacattttctgaggctgaacaac
aacaagatacggaacattcttccagaagaaatttgcaatgctgaagaggatgatgactca
aatctggaacatcttcatcttgaaaacaattatattaaaattagagaaataccatcttac
acattttcatgcataagatcatactcaagtatcgttcttaaaccacaaaacatcaagtaa

DBGET integrated database retrieval system