KEGG   Homo sapiens (human): 1843Help
Entry
1843              CDS       T01001                                 

Gene name
DUSP1, CL100, HVH1, MKP-1, MKP1, PTPN10
Definition
(RefSeq) dual specificity phosphatase 1
  KO
K21278  
dual specificity protein phosphatase 1 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Serotonergic synapse
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1843 (DUSP1)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    1843 (DUSP1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1843 (DUSP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1843 (DUSP1)
    3.1.3.48  protein-tyrosine-phosphatase
     1843 (DUSP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    1843 (DUSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P28562(Tchem)
UniProt: 
Position
5q35.1
AA seq 367 aa AA seqDB search
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggaagtgggcaccctggacgctggaggcctgcgggcgctgctgggggagcga
gcggcgcaatgcctgctgctggactgccgctccttcttcgctttcaacgccggccacatc
gccggctctgtcaacgtgcgcttcagcaccatcgtgcggcgccgggccaagggcgccatg
ggcctggagcacatcgtgcccaacgccgagctccgcggccgcctgctggccggcgcctac
cacgccgtggtgttgctggacgagcgcagcgccgccctggacggcgccaagcgcgacggc
accctggccctggcggccggcgcgctctgccgcgaggcgcgcgccgcgcaagtcttcttc
ctcaaaggaggatacgaagcgttttcggcttcctgcccggagctgtgcagcaaacagtcg
acccccatggggctcagccttcccctgagtactagcgtccctgacagcgcggaatctggg
tgcagttcctgcagtaccccactctacgatcagggtggcccggtggaaatcctgcccttt
ctgtacctgggcagtgcgtatcacgcttcccgcaaggacatgctggatgccttgggcatc
actgccttgatcaacgtctcagccaattgtcccaaccattttgagggtcactaccagtac
aagagcatccctgtggaggacaaccacaaggcagacatcagctcctggttcaacgaggcc
attgacttcatagactccatcaagaatgctggaggaagggtgtttgtccactgccaggca
ggcatttcccggtcagccaccatctgccttgcttaccttatgaggactaatcgagtcaag
ctggacgaggcctttgagtttgtgaagcagaggcgaagcatcatctctcccaacttcagc
ttcatgggccagctgctgcagtttgagtcccaggtgctggctccgcactgttcggcagag
gctgggagccccgccatggctgtgctcgaccgaggcacctccaccaccaccgtgttcaac
ttccccgtctccatccctgtccactccacgaacagtgcgctgagctaccttcagagcccc
attacgacctctcccagctgctga

DBGET integrated database retrieval system