KEGG   Homo sapiens (human): 1845Help
Entry
1845              CDS       T01001                                 

Gene name
DUSP3, VHR
Definition
(RefSeq) dual specificity phosphatase 3
  KO
K17614  dual specificity phosphatase 3 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1845 (DUSP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1845 (DUSP3)
    3.1.3.48  protein-tyrosine-phosphatase
     1845 (DUSP3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    1845 (DUSP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Init_tRNA_PT Y_phosphatase2 DUF442 Myotub-related
Motif
Other DBs
NCBI-GeneID: 1845
NCBI-ProteinID: NP_004081
OMIM: 600183
HGNC: 3069
Ensembl: ENSG00000108861
Vega: OTTHUMG00000180889
Pharos: P51452(Tchem)
UniProt: P51452
Structure
PDB: 

Jmol
Position
17q21.31
AA seq 185 aa AA seqDB search
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcgttcgagctctcggtgcaggatctcaacgacctgctctcggacggcagc
ggctgctacagcctcccgagccagccctgcaacgaggtcaccccgcggatctacgtgggc
aacgcgtctgtggctcaggacatccccaagctgcagaaactaggcatcacccatgtgctg
aacgcggctgagggcaggtccttcatgcacgtcaacaccaatgccaacttctacaaggac
tccggcatcacatacctgggcatcaaggccaacgacacacaggagttcaacctcagcgct
tactttgaaagggctgccgacttcattgaccaggctttggctcaaaagaatggccgggtg
ctcgtccactgccgggaaggttatagccgctccccaacgctagttatcgcctacctcatg
atgcggcagaagatggacgtcaagtctgccctgagcatcgtgaggcagaaccgtgagatc
ggccccaacgatggcttcctggcccagctctgccagctcaatgacagactagccaaggag
gggaagttgaaaccctag

DBGET integrated database retrieval system