KEGG   Homo sapiens (human): 1845Help
Entry
1845              CDS       T01001                                 

Gene name
DUSP3, VHR
Definition
dual specificity phosphatase 3 (EC:3.1.3.16 3.1.3.48)
Orthology
K17614  
dual specificity phosphatase 3 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21
AA seq 185 aa AA seqDB search
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcgttcgagctctcggtgcaggatctcaacgacctgctctcggacggcagc
ggctgctacagcctcccgagccagccctgcaacgaggtcaccccgcggatctacgtgggc
aacgcgtctgtggctcaggacatccccaagctgcagaaactaggcatcacccatgtgctg
aacgcggctgagggcaggtccttcatgcacgtcaacaccaatgccaacttctacaaggac
tccggcatcacatacctgggcatcaaggccaacgacacacaggagttcaacctcagcgct
tactttgaaagggctgccgacttcattgaccaggctttggctcaaaagaatggccgggtg
ctcgtccactgccgggaaggttatagccgctccccaacgctagttatcgcctacctcatg
atgcggcagaagatggacgtcaagtctgccctgagcatcgtgaggcagaaccgtgagatc
ggccccaacgatggcttcctggcccagctctgccagctcaatgacagactagccaaggag
gggaagttgaaaccctag

DBGET integrated database retrieval system