KEGG   Homo sapiens (human): 1846Help
Entry
1846              CDS       T01001                                 

Gene name
DUSP4, HVH2, MKP-2, MKP2, TYP
Definition
dual specificity phosphatase 4 (EC:3.1.3.16 3.1.3.48)
Orthology
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1846 (DUSP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1846 (DUSP4)
    3.1.3.48  protein-tyrosine-phosphatase
     1846 (DUSP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12-p11
AA seq 394 aa AA seqDB search
MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGY
ILGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLRE
DSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLD
LGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHY
QYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR
VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATP
TSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgatggaggagctgcgggagatggactgcagtgtgctcaaaaggctgatgaac
cgggacgagaatggcggcggcgcgggcggcagcggcagccacggcaccctggggctgccg
agcggcggcaagtgcctgctgctggactgcagaccgttcctggcgcacagcgcgggctac
atcctaggttcggtcaacgtgcgctgtaacaccatcgtgcggcggcgggctaagggctcc
gtgagcctggagcagatcctgcccgccgaggaggaggtacgcgcccgcttgcgctccggc
ctctactcggcggtcatcgtctacgacgagcgcagcccgcgcgccgagagcctccgcgag
gacagcaccgtgtcgctggtggtgcaggcgctgcgccgcaacgccgagcgcaccgacatc
tgcctgctcaaaggcggctatgagaggttttcctccgagtacccagaattctgttctaaa
accaaggccctggcagccatcccacccccggttccccccagtgccacagagcccttggac
ctgggctgcagctcctgtgggaccccactacacgaccaggggggtcctgtggagatcctt
cccttcctctacctcggcagtgcctaccatgctgcccggagagacatgctggacgccctg
ggcatcacggctctgttgaatgtctcctcggactgcccaaaccactttgaaggacactat
cagtacaagtgcatcccagtggaagataaccacaaggccgacatcagctcctggttcatg
gaagccatagagtacatcgatgccgtgaaggactgccgtgggcgcgtgctggtgcactgc
caggcgggcatctcgcggtcggccaccatctgcctggcctacctgatgatgaagaaacgg
gtgaggctggaggaggccttcgagttcgttaagcagcgccgcagcatcatctcgcccaac
ttcagcttcatggggcagctgctgcagttcgagtcccaggtgctggccacgtcctgtgct
gcggaggctgctagcccctcgggacccctgcgggagcggggcaagacccccgccaccccc
acctcgcagttcgtcttcagctttccggtctccgtgggcgtgcactcggcccccagcagc
ctgccctacctgcacagccccatcaccacctctcccagctgttag

DBGET integrated database retrieval system