KEGG   Homo sapiens (human): 1848Help
Entry
1848              CDS       T01001                                 

Gene name
DUSP6, HH19, MKP3, PYST1
Definition
dual specificity phosphatase 6 (EC:3.1.3.16 3.1.3.48)
Orthology
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Transcriptional misregulation in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q22-q23
AA seq 381 aa AA seqDB search
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTTPSNQNVYQVDSLQST
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatagatacgctcagacccgtgcccttcgcgtcggaaatggcgatcagcaagacggtg
gcgtggctcaacgagcagctggagctgggcaacgagcggctgctgctgatggactgccgg
ccgcaggagctatacgagtcgtcgcacatcgagtcggccatcaacgtggccatcccgggc
atcatgctgcggcgcctgcagaagggtaacctgccggtgcgcgcgctcttcacgcgcggc
gaggaccgggaccgcttcacccggcgctgtggcaccgacacagtggtgctctacgacgag
agcagcagcgactggaacgagaatacgggcggcgagtcggtgctcgggctgctgctcaag
aagctcaaggacgagggctgccgggcgttctacctggaaggtggcttcagtaagttccaa
gccgagttctccctgcattgcgagaccaatctagacggctcgtgtagcagcagctcgccg
ccgttgccagtgctggggctcgggggcctgcggatcagctctgactcttcctcggacatc
gagtctgaccttgaccgagaccccaatagtgcaacagactcggatggtagtccgctgtcc
aacagccagccttccttcccagtggagatcttgcccttcctctacttgggctgtgccaaa
gactccaccaacttggacgtgttggaggaattcggcatcaagtacatcttgaacgtcacc
cccaatttgccgaatctctttgagaacgcaggagagtttaaatacaagcaaatccccatc
tcggatcactggagccaaaacctgtcccagtttttccctgaggccatttctttcatagat
gaagcccggggcaagaactgtggtgtcttggtacattgcttggctggcattagccgctca
gtcactgtgactgtggcttaccttatgcagaagctcaatctgtcgatgaacgatgcctat
gacattgtcaaaatgaaaaaatccaacatatcccctaacttcaacttcatgggtcagctg
ctggacttcgagaggacgctgggactcagcagcccatgtgacaacagggttccagcacag
cagctgtattttaccaccccttccaaccagaatgtataccaggtggactctctgcaatct
acgtga

DBGET integrated database retrieval system