KEGG   Homo sapiens (human): 1850Help
Entry
1850              CDS       T01001                                 

Gene name
DUSP8, C11orf81, HB5, HVH-5, HVH8
Definition
dual specificity phosphatase 8 (EC:3.1.3.16 3.1.3.48)
Orthology
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1850 (DUSP8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1850 (DUSP8)
    3.1.3.48  protein-tyrosine-phosphatase
     1850 (DUSP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 625 aa AA seqDB search
MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPAARSQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTGGFATFSSCFPGLCEGKPAALLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKD
LMTQNGISYVLNASNSCPKPDFICESRFMRVPINDNYCEKLLPWLDKSIEFIDKAKLSSC
QVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSL
KLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAREGGLSAGGEPPA
PPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRPDGPGPPDPGEAP
KLCKLDSPSGAALGLSSPSPDSPDAAPEARPRPRRRPRPPAGSPARSPAHSLGLNFGDAA
RQTPRHGLSALSAPGLPGPGQPAGPGAWAPPLDSPGTPSPDGPWCFSPEGAQGAGGVLFA
PFGRAGAPGPGGGSDLRRREAARAEPRDARTGWPEEPAPETQFKRRSCQMEFEEGMVEGR
ARGEELAALGKQASFSGSVEVIEVS
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggctggggaccggctcccgaggaaggtgatggatgccaagaagctggccagcctgctg
cggggcgggcctggggggccgctggtcatcgacagccgctccttcgtggagtacaacagc
tggcatgtgctcagctccgtcaacatctgctgctccaagctggtgaagcggcggctgcag
cagggcaaggtgaccattgcggagctcatccagccggctgcacgcagccaggtggaggct
acggagccacaggacgtggtggtctatgaccagagcacgcgggacgccagcgtgctggcc
gcagacagcttcctctccatcctgctgagcaagctggacggctgcttcgacagcgtggcc
atcctcactgggggcttcgccaccttctcctcctgcttccccggcctctgcgagggcaag
cctgctgccctgctacccatgagcctctcccagccctgcctgcctgtgcccagcgtgggc
ctgacccgcatcctgcctcacctctacctgggctcgcagaaggacgtcctaaacaaggat
ctgatgacgcaaaatggaataagctacgtcctcaacgccagcaactcctgccccaagcct
gacttcatctgcgagagccgcttcatgcgggtccccatcaacgacaactactgtgaaaaa
ctgctgccctggctggacaagtccatcgagttcatcgataaagccaagctctccagctgc
caagtcatcgtccactgtctggctggcatctcccgctctgccaccatcgccatcgcctac
atcatgaagaccatgggcatgtcctccgacgacgcctacaggttcgtgaaggacaggcgc
ccgtccatctcgcccaacttcaacttcctgggccagctgctggagtacgagcgcagcctg
aagctgctggccgccctgcagggcgacccgggcaccccctcagggacgccggagcctccg
cccagtcctgccgccggggccccgctgccacggctgccaccacctacctcagagagcgct
gccacagggaatgcggctgccagggagggcggcctgagcgcgggcggggagccccccgcg
ccccccacgcccccggcgaccagcgcactgcagcagggcctgcgcggcctgcacctctcc
tcggaccgcctgcaggacactaaccgcctcaagcgctccttctccctggacatcaagtct
gcctacgcccctagcaggcggcccgacggccccgggccccccgaccccggcgaggccccg
aagctctgcaagctggacagcccgtcgggggccgcgctgggcctgtcctcgcccagcccg
gacagcccggacgccgcgcctgaggcgcgcccacggccccgccggcggccccggcccccc
gccggctcccccgcgcgctcccccgcgcacagcctcggcctgaacttcggcgatgcggcc
cggcagactccgcggcacggcctctcggccctgtcggcgcccgggctgcccggccctggc
cagccggccggccccggggcctgggcaccgccgctcgactccccaggcacgccgtcgccc
gacgggccctggtgcttcagccccgagggcgcacagggggcgggcggggtgctgtttgcg
cccttcggccgggcgggcgccccgggaccaggcggcggcagcgacctgcggcggcgggag
gcagcgagggctgagccccgggacgcgcggaccggctggcccgaggagccggccccggag
acgcagttcaagcgccgcagctgccagatggagttcgaggagggcatggtggaggggcgc
gcgcgcggcgaggagctggccgccctgggcaagcaggcgagcttctcgggcagcgtggag
gtcatcgaggtgtcctga

DBGET integrated database retrieval system