KEGG   Homo sapiens (human): 1852Help
Entry
1852              CDS       T01001                                 

Gene name
DUSP9, MKP-4, MKP4
Definition
dual specificity phosphatase 9 (EC:3.1.3.16 3.1.3.48)
Orthology
K18498  
dual specificity phosphatase 9 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1852 (DUSP9)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    1852 (DUSP9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1852 (DUSP9)
    3.1.3.48  protein-tyrosine-phosphatase
     1852 (DUSP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 384 aa AA seqDB search
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLA
YYLQGGFSRFQAECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADR
DSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNL
PNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQA
SAASNPPSFFTTPTSDGAFELAPT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggagggtctgggccgctcgtgcctgtggctgcgtcgggagctgtcgcccccgcggccg
cggctcctgctcctggactgccgcagccgcgagctgtacgagtcggcgcgcatcggtggg
gcgctgagcgtggccctgccggcgctcctgctgcgccgcctgcggaggggcagcctgtcg
gtgcgcgcgctcctgcctgggccgccgctgcagccgcccccgcctgcccccgtgctcctg
tacgaccagggcgggggccggcgccggcgcggggaggccgaggccgaggccgaggagtgg
gaggccgagtcggtgctgggcaccctgctgcagaagctgcgagaggaaggctacctggcc
tactacctccagggaggcttcagcagattccaggccgagtgccctcacctgtgtgagacc
agccttgctggccgtgccggctccagcatggcgccggtgcccggtccagtgcccgtggtg
gggttgggcagcctgtgcctgggctccgactgctctgatgcggaatccgaggctgaccgc
gactccatgagctgtggcctggattcggagggtgccacacccccaccagtggggctgcgg
gcatccttccctgtccagatcctgcccaacctctatctgggcagtgcccgggattccgcc
aatttggagagcctggccaaactgggcatccgctacatcctcaatgtcacccccaacctc
ccaaacttcttcgagaagaatggtgactttcactacaagcagatccccatctccgaccac
tggagccagaacctgtcgcggttctttccggaggccattgagttcattgatgaggccttg
tcccagaactgcggggtgctcgtccactgcttggcgggggtcagccgttctgtcaccgtc
actgtggcctacctcatgcagaagctccacctctctctcaacgatgcctatgacctggtc
aagaggaagaagtctaacatctcccccaacttcaacttcatggggcagttgctggacttt
gagcgcagcttgcggctggaggagcgccactcgcaggagcagggcagtggggggcaggca
tctgcggcctccaacccgccctccttcttcaccacccccaccagtgatggcgccttcgag
ctggcccccacctag

DBGET integrated database retrieval system