KEGG   Homo sapiens (human): 1852Help
Entry
1852              CDS       T01001                                 

Gene name
DUSP9, MKP-4, MKP4
Definition
dual specificity phosphatase 9 (EC:3.1.3.16 3.1.3.48)
Orthology
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 384 aa AA seqDB search
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLA
YYLQGGFSRFQAECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADR
DSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNL
PNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQA
SAASNPPSFFTTPTSDGAFELAPT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggagggtctgggccgctcgtgcctgtggctgcgtcgggagctgtcgcccccgcggccg
cggctcctgctcctggactgccgcagccgcgagctgtacgagtcggcgcgcatcggtggg
gcgctgagcgtggccctgccggcgctcctgctgcgccgcctgcggaggggcagcctgtcg
gtgcgcgcgctcctgcctgggccgccgctgcagccgcccccgcctgcccccgtgctcctg
tacgaccagggcgggggccggcgccggcgcggggaggccgaggccgaggccgaggagtgg
gaggccgagtcggtgctgggcaccctgctgcagaagctgcgagaggaaggctacctggcc
tactacctccagggaggcttcagcagattccaggccgagtgccctcacctgtgtgagacc
agccttgctggccgtgccggctccagcatggcgccggtgcccggtccagtgcccgtggtg
gggttgggcagcctgtgcctgggctccgactgctctgatgcggaatccgaggctgaccgc
gactccatgagctgtggcctggattcggagggtgccacacccccaccagtggggctgcgg
gcatccttccctgtccagatcctgcccaacctctatctgggcagtgcccgggattccgcc
aatttggagagcctggccaaactgggcatccgctacatcctcaatgtcacccccaacctc
ccaaacttcttcgagaagaatggtgactttcactacaagcagatccccatctccgaccac
tggagccagaacctgtcgcggttctttccggaggccattgagttcattgatgaggccttg
tcccagaactgcggggtgctcgtccactgcttggcgggggtcagccgttctgtcaccgtc
actgtggcctacctcatgcagaagctccacctctctctcaacgatgcctatgacctggtc
aagaggaagaagtctaacatctcccccaacttcaacttcatggggcagttgctggacttt
gagcgcagcttgcggctggaggagcgccactcgcaggagcagggcagtggggggcaggca
tctgcggcctccaacccgccctccttcttcaccacccccaccagtgatggcgccttcgag
ctggcccccacctag

DBGET integrated database retrieval system