KEGG   Homo sapiens (human): 1854Help
Entry
1854              CDS       T01001                                 

Gene name
DUT, dUTPase
Definition
deoxyuridine triphosphatase (EC:3.6.1.23)
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    1854 (DUT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     1854 (DUT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21.1
AA seq 252 aa AA seqDB search
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactcccctctgccctcgccccgcgctctgctaccatttccttacgtctctgcttcgc
tcagcgatgcaaaacgcgcgaggcgcacggcagagggccgaagccgcggtactctccggg
ccaggcccgcccctcggccgcgccgcgcagcacgggattccccggccgctgtccagcgct
ggccgcctgagccaaggctgccgcggagccagtacagtcggggccgctggctggaagggc
gagcttcctaaggcggggggaagcccggcgccggggccggagacacccgccatttcaccc
agtaagcgggcccggcctgcggaggtgggcggcatgcagctccgctttgcccggctctcc
gagcacgccacggcccccacccggggctccgcgcgcgccgcgggctacgacctgtacagt
gcctatgattacacaataccacctatggagaaagctgttgtgaaaacggacattcagata
gcgctcccttctgggtgttatggaagagtggctccacggtcaggcttggctgcaaaacac
tttattgatgtaggagctggtgtcatagatgaagattatagaggaaatgttggtgttgta
ctgtttaattttggcaaagaaaagtttgaagtcaaaaaaggtgatcgaattgcacagctc
atttgcgaacggattttttatccagaaatagaagaagttcaagccttggatgacaccgaa
aggggttcaggaggttttggttccactggaaagaattaa

DBGET integrated database retrieval system