KEGG   Homo sapiens (human): 1855Help
Entry
1855              CDS       T01001                                 

Gene name
DVL1, DVL, DVL1L1, DVL1P1
Definition
dishevelled segment polarity protein 1
Orthology
K02353  
segment polarity protein dishevelled
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Notch signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1855 (DVL1)
   04330 Notch signaling pathway
    1855 (DVL1)
   04390 Hippo signaling pathway
    1855 (DVL1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    1855 (DVL1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1855 (DVL1)
   05217 Basal cell carcinoma
    1855 (DVL1)
  Infectious diseases
   05166 HTLV-I infection
    1855 (DVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36
AA seq 670 aa AA seqDB search
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSAST
ALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDP
AAWLSHTAALTGALPRYELEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAV
IGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLA
TLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGST
GSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLS
RGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMG
NPCEFFVDIM
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaccaagattatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcccccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttctttaagtccatggaccaggacttcggggtggtgaag
gaggagatctttgatgacaatgccaagcttccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggtgctcactcggatgcggggtcccagggcacggacagccacaca
gacctgcccccgcctcttgagcggacaggcggcatcggggactcccggcccccctccttc
cacccaaatgtggccagcagccgtgacgggatggacaacgagacaggcacggagtccatg
gtcagtcaccggcgggagcgtgcccgacgccggaaccgcgaggaggccgcccggaccaat
gggcacccaaggggagaccgacggcgggatgtggggctgcccccagacagcgcgtccacc
gccctcagcagcgagcttgagtccagcagctttgtggactcggacgaggatggcagcacg
agcaggctcagcagctccacggagcagagcacctcatccagactcatccggaagcacaaa
cgccggcggaggaagcagcgccttcggcaggcggaccgggcctcctccttcagcagcata
accgactccaccatgtccctcaacatcgtcactgtcacgctcaacatggaaagacatcac
tttctgggcatcagcatcgtggggcagagcaacgaccgtggagacggcggcatctacatt
ggctccatcatgaagggcggggctgtggccgctgacggccgcatcgagcccggcgacatg
ttgctgcaggtgaatgacgtgaactttgagaacatgagcaatgacgatgccgtgcgggtg
ctgcgggagatcgtttcccagacggggcccatcagcctcactgtggccaagtgctgggac
ccaacgccccgaagctacttcaccgtcccacgggctgacccggtgcggcccatcgacccc
gccgcctggctgtcccacacggcggcactgacaggagccctgccccgctacgagctggaa
gaggcgccgctgacggtgaagagtgacatgagcgccgtcgtccgggtcatgcagctgcca
gactcgggactggagatccgcgaccgcatgtggctcaagatcaccatcgccaatgccgtc
atcggggcggacgtggtggactggctgtacacacacgtggagggcttcaaggagcggcgg
gaggcccggaagtacgccagcagcttgctgaagcacggcttcctgcggcacacggtcaac
aagatcaccttctccgagcagtgctactacgtcttcggggatctctgcagcaatctcgcc
accctgaacctcaacagtggctccagtgggacttcggatcaggacacgctggccccgctg
ccccacccggctgccccctggcctctgggtcagggctacccctaccagtacccgggaccc
ccaccctgcttcccgcctgcctaccaggacccgggctttagctatggcagcggcagcacc
gggagtcagcagagtgaagggagcaaaagcagtgggtccacccggagcagccgccgggcc
ccgggccgtgagaaggagcgtcgggcggcgggagctgggggcagtggcagtgaatcggat
cacacggcaccgagtggggtggggagcagctggcgagagcgtccggccggccagctcagc
cgtggcagcagcccacgcagtcaggcctcggctaccgccccggggctccccccgccccac
cccacgaccaaggcctatacagtggtgggggggccacccgggggaccccctgtccgggag
ctggctgccgtccccccggaattgacaggcagccgccagtccttccagaaggctatgggg
aacccctgcgagttcttcgtggacatcatgtga

DBGET integrated database retrieval system