KEGG   Homo sapiens (human): 1855Help
Entry
1855              CDS       T01001                                 

Gene name
DVL1, DRS2, DVL, DVL1L1, DVL1P1
Definition
(RefSeq) dishevelled segment polarity protein 1
  KO
K02353  
segment polarity protein dishevelled
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Notch signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Human papillomavirus infection
HTLV-I infection
Pathways in cancer
Basal cell carcinoma
Breast cancer
Module
Wnt signaling
Disease
H00485  
Robinow syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1855 (DVL1)
   04330 Notch signaling pathway
    1855 (DVL1)
   04390 Hippo signaling pathway
    1855 (DVL1)
   04150 mTOR signaling pathway
    1855 (DVL1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1855 (DVL1)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    1855 (DVL1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1855 (DVL1)
   05217 Basal cell carcinoma
    1855 (DVL1)
   05224 Breast cancer
    1855 (DVL1)
  Infectious diseases
   05166 HTLV-I infection
    1855 (DVL1)
   05165 Human papillomavirus infection
    1855 (DVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14640(Tbio)
UniProt: 
Position
1p36.33
AA seq 695 aa AA seqDB search
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSAST
ALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGS
GSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaccaagattatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcccccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttctttaagtccatggaccaggacttcggggtggtgaag
gaggagatctttgatgacaatgccaagcttccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggtgctcactcggatgcggggtcccagggcacggacagccacaca
gacctgcccccgcctcttgagcggacaggcggcatcggggactcccggcccccctccttc
cacccaaatgtggccagcagccgtgacgggatggacaacgagacaggcacggagtccatg
gtcagtcaccggcgggagcgtgcccgacgccggaaccgcgaggaggccgcccggaccaat
gggcacccaaggggagaccgacggcgggatgtggggctgcccccagacagcgcgtccacc
gccctcagcagcgagcttgagtccagcagctttgtggactcggacgaggatggcagcacg
agcaggctcagcagctccacggagcagagcacctcatccagactcatccggaagcacaaa
cgccggcggaggaagcagcgccttcggcaggcggaccgggcctcctccttcagcagcata
accgactccaccatgtccctcaacatcgtcactgtcacgctcaacatggaaagacatcac
tttctgggcatcagcatcgtggggcagagcaacgaccgtggagacggcggcatctacatt
ggctccatcatgaagggcggggctgtggccgctgacggccgcatcgagcccggcgacatg
ttgctgcaggtgaatgacgtgaactttgagaacatgagcaatgacgatgccgtgcgggtg
ctgcgggagatcgtttcccagacggggcccatcagcctcactgtggccaagtgctgggac
ccaacgccccgaagctacttcaccgtcccacgggctgacccggtgcggcccatcgacccc
gccgcctggctgtcccacacggcggcactgacaggagccctgccccgctacggtacgagt
ccctgctccagcgccgtcacgcgcaccagctcctcctcactaaccagctccgtgcctggt
gctccacagctggaagaggcgccgctgacggtgaagagtgacatgagcgccgtcgtccgg
gtcatgcagctgccagactcgggactggagatccgcgaccgcatgtggctcaagatcacc
atcgccaatgccgtcatcggggcggacgtggtggactggctgtacacacacgtggagggc
ttcaaggagcggcgggaggcccggaagtacgccagcagcttgctgaagcacggcttcctg
cggcacacggtcaacaagatcaccttctccgagcagtgctactacgtcttcggggatctc
tgcagcaatctcgccaccctgaacctcaacagtggctccagtgggacttcggatcaggac
acgctggccccgctgccccacccggctgccccctggcctctgggtcagggctacccctac
cagtacccgggacccccaccctgcttcccgcctgcctaccaggacccgggctttagctat
ggcagcggcagcaccgggagtcagcagagtgaagggagcaaaagcagtgggtccacccgg
agcagccgccgggccccgggccgtgagaaggagcgtcgggcggcgggagctgggggcagt
ggcagtgaatcggatcacacggcaccgagtggggtggggagcagctggcgagagcgtccg
gccggccagctcagccgtggcagcagcccacgcagtcaggcctcggctaccgccccgggg
ctccccccgccccaccccacgaccaaggcctatacagtggtgggggggccacccggggga
ccccctgtccgggagctggctgccgtccccccggaattgacaggcagccgccagtccttc
cagaaggctatggggaacccctgcgagttcttcgtggacatcatgtga

DBGET integrated database retrieval system