KEGG   Homo sapiens (human): 1856Help
Entry
1856              CDS       T01001                                 

Gene name
DVL2
Definition
dishevelled segment polarity protein 2
Orthology
K02353  
segment polarity protein dishevelled
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Notch signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Basal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 736 aa AA seqDB search
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtagcagcactgggggcggtggggttggggagacgaaggtgatttaccacctg
gatgaggaagagactccctacctggtgaagatccctgtccccgccgagcgcatcaccctc
ggcgatttcaagagcgtcctgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagaaatttcagatgacaacgcccgcctcccctgc
ttcaacggaagggtggtatcctggctggtgtcctcagataatccccaacccgagatggcc
cctccagtccatgagcctcgggcagaactggcgcctccagccccacctttacctcctttg
ccacccgagaggaccagcggcattggggactcaaggcctccatccttccaccctaatgtg
tccagcagccatgagaatctggagcctgagacagaaaccgagtcagtagtgtcactgagg
cgggagcggcctcgcaggagagacagcagtgagcatggcgctgggggccacaggactggt
ggcccctcaaggctggagcgccacctggccggatacgagagctcctctaccctcatgacc
agcgagctggagagtaccagcctgggggactcggacgaggaggacaccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctccttaagcgccaccggcggcgaagg
aagcagaggccaccccgcctggagaggacgtcatccttcagcagcgtcacagattccaca
atgtctctcaatatcatcacagtcacgctaaacatggagaagtacaacttcctgggtatc
tccattgttggccagagcaatgagcggggagacggaggcatctacattggctccatcatg
aagggtggggctgtggcggccgacgggcgcattgagccaggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaacgatgacgctgtgcgggtgctgagggacatt
gtgcacaagcctggccccattgtgctgactgtggccaagtgctgggatccctctcctcag
gcctatttcactctcccccgaaatgagcccatccagccaattgaccctgctgcctgggtg
tcccattccgcggctctgactggcaccttcccagcctatccaggttcctcctccatgagc
accattacatctggatcgtctttgcctgatggctgtgaaggccggggtctctccgtccat
acggacatggcatcggtgaccaaggccatggcagctccagagtctggactggaagtccgg
gaccgcatgtggctcaagatcaccatccctaatgcctttctgggctcggatgtggttgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaagtatgccagc
gggctgctcaaagcaggcctgatccgacacaccgtcaacaagatcaccttctctgagcag
tgctattacgtcttcggagacctcagtggtggctgtgagagctacctagtcaacctgtct
ctcaatgacaacgatggctccagtggggcttcagaccaggataccctggctcctctgcct
ggggccaccccctggcccctgctgcccactttctcctaccaataccctgccccacacccc
tacagcccgcagcctccaccctaccatgagctttcatcttacacctatggtgggggcagt
gccagcagccagcatagtgagggcagccggagcagtgggtcgacacggagtgatgggggg
gcagggcgcacggggaggcccgaggagcgggcccccgagtccaagtccggcagtggcagt
gagtctgagccctccagccgagggggcagccttcggcggggtggggaagcaagtgggact
agcgatgggggccctcctccatccagaggctcaactgggggtgcccctaatctccgagcc
cacccagggctccatccctatggaccgccccctggcatggccctcccctacaaccccatg
atggtggtcatgatgcccccacctccacctccagtccctccagcagtgcagcctccgggg
gcccctccagtcagagacctgggctctgtgcccccagaactgacagccagccgccaaagc
ttccacatggccatgggcaatcccagcgagttctttgtggatgttatgtag

DBGET integrated database retrieval system