KEGG   Homo sapiens (human): 1856Help
Entry
1856              CDS       T01001                                 

Gene name
DVL2
Definition
dishevelled segment polarity protein 2
Orthology
K02353  
segment polarity protein dishevelled
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Notch signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1856 (DVL2)
   04330 Notch signaling pathway
    1856 (DVL2)
   04390 Hippo signaling pathway
    1856 (DVL2)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    1856 (DVL2)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    1856 (DVL2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1856 (DVL2)
   05217 Basal cell carcinoma
    1856 (DVL2)
  Infectious diseases
   05166 HTLV-I infection
    1856 (DVL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 736 aa AA seqDB search
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtagcagcactgggggcggtggggttggggagacgaaggtgatttaccacctg
gatgaggaagagactccctacctggtgaagatccctgtccccgccgagcgcatcaccctc
ggcgatttcaagagcgtcctgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagaaatttcagatgacaacgcccgcctcccctgc
ttcaacggaagggtggtatcctggctggtgtcctcagataatccccaacccgagatggcc
cctccagtccatgagcctcgggcagaactggcgcctccagccccacctttacctcctttg
ccacccgagaggaccagcggcattggggactcaaggcctccatccttccaccctaatgtg
tccagcagccatgagaatctggagcctgagacagaaaccgagtcagtagtgtcactgagg
cgggagcggcctcgcaggagagacagcagtgagcatggcgctgggggccacaggactggt
ggcccctcaaggctggagcgccacctggccggatacgagagctcctctaccctcatgacc
agcgagctggagagtaccagcctgggggactcggacgaggaggacaccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctccttaagcgccaccggcggcgaagg
aagcagaggccaccccgcctggagaggacgtcatccttcagcagcgtcacagattccaca
atgtctctcaatatcatcacagtcacgctaaacatggagaagtacaacttcctgggtatc
tccattgttggccagagcaatgagcggggagacggaggcatctacattggctccatcatg
aagggtggggctgtggcggccgacgggcgcattgagccaggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaacgatgacgctgtgcgggtgctgagggacatt
gtgcacaagcctggccccattgtgctgactgtggccaagtgctgggatccctctcctcag
gcctatttcactctcccccgaaatgagcccatccagccaattgaccctgctgcctgggtg
tcccattccgcggctctgactggcaccttcccagcctatccaggttcctcctccatgagc
accattacatctggatcgtctttgcctgatggctgtgaaggccggggtctctccgtccat
acggacatggcatcggtgaccaaggccatggcagctccagagtctggactggaagtccgg
gaccgcatgtggctcaagatcaccatccctaatgcctttctgggctcggatgtggttgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaagtatgccagc
gggctgctcaaagcaggcctgatccgacacaccgtcaacaagatcaccttctctgagcag
tgctattacgtcttcggagacctcagtggtggctgtgagagctacctagtcaacctgtct
ctcaatgacaacgatggctccagtggggcttcagaccaggataccctggctcctctgcct
ggggccaccccctggcccctgctgcccactttctcctaccaataccctgccccacacccc
tacagcccgcagcctccaccctaccatgagctttcatcttacacctatggtgggggcagt
gccagcagccagcatagtgagggcagccggagcagtgggtcgacacggagtgatgggggg
gcagggcgcacggggaggcccgaggagcgggcccccgagtccaagtccggcagtggcagt
gagtctgagccctccagccgagggggcagccttcggcggggtggggaagcaagtgggact
agcgatgggggccctcctccatccagaggctcaactgggggtgcccctaatctccgagcc
cacccagggctccatccctatggaccgccccctggcatggccctcccctacaaccccatg
atggtggtcatgatgcccccacctccacctccagtccctccagcagtgcagcctccgggg
gcccctccagtcagagacctgggctctgtgcccccagaactgacagccagccgccaaagc
ttccacatggccatgggcaatcccagcgagttctttgtggatgttatgtag

DBGET integrated database retrieval system