KEGG   Homo sapiens (human): 1859Help
Entry
1859              CDS       T01001                                 

Gene name
DYRK1A, DYRK, DYRK1, HP86, MNB, MNBH, MRD7
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A (EC:2.7.12.1)
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Disease
H00773  
Autosomal dominant mental retardation
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     1859 (DYRK1A)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   1859 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.13
AA seq 763 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgttcggcttgcaccgtca
ttttcattccatgctgctggccttcagatggctggacagatgccccattcacatcagtac
agtgaccgtcgccagccaaacataagtgaccaacaggtttctgccttatcatattctgac
cagattcagcaacctctaactaaccaggtgatgcctgatattgtcatgttacagaggcgg
atgccccaaaccttccgtgacccagcaactgctcccctgagaaaactttctgttgacttg
atcaaaacatacaagcatattaatgaggtttactatgcaaaaaagaagcgaagacaccaa
cagggccagggagacgattctagtcataagaaggaacggaaggtttacaatgatggttat
gatgatgataactatgattatattgtaaaaaacggagaaaagtggatggatcgttacgaa
attgactccttgataggcaaaggttcctttggacaggttgtaaaggcatatgatcgtgtg
gagcaagaatgggttgccattaaaataataaagaacaagaaggcttttctgaatcaagca
cagatagaagtgcgacttcttgagctcatgaacaaacatgacactgaaatgaaatactac
atagtgcatttgaaacgccactttatgtttcgaaaccatctctgtttagtttttgaaatg
ctgtcctacaacctctatgacttgctgagaaacaccaatttccgaggggtctctttgaac
ctaacacgaaagtttgcgcaacagatgtgcactgcactgcttttccttgcgactccagaa
cttagtatcattcactgtgatctaaaacctgaaaatatccttctttgtaaccccaaacgc
agtgcaatcaagatagttgactttggcagttcttgtcagttggggcagaggatataccag
tatattcagagtcgcttttatcggtctccagaggtgctactgggaatgccttatgacctt
gccattgatatgtggtccctcgggtgtattttggttgaaatgcacactggagaacctctg
ttcagtggtgccaatgaggtagatcagatgaataaaatagtggaagttctgggtattcca
cctgctcatattcttgaccaagcaccaaaagcaagaaagttctttgagaagttgccagat
ggcacttggaacttaaagaagaccaaagatggaaaacgggagtacaaaccaccaggaacc
cgtaaacttcataacattcttggagtggaaacaggaggacctggtgggcgacgtgctggg
gagtcaggtcatacggtcgctgactacttgaagttcaaagacctcattttaaggatgctt
gattatgaccccaaaactcgaattcaaccttattatgctctgcagcacagtttcttcaag
aaaacagctgatgaaggtacaaatacaagtaatagtgtatctacaagccccgccatggag
cagtctcagtcttcgggcaccacctccagtacatcgtcaagctcaggtggctcatcgggg
acaagcaacagtgggagagcccggtcggatccgacgcaccagcatcggcacagtggtggg
cacttcacagctgccgtgcaggccatggactgcgagacacacagtccccaggtgcgtcag
caatttcctgctcctcttggttggtcaggcactgaagctcctacacaggtcactgttgaa
actcatcctgttcaagaaacaacctttcatgtagcccctcaacagaatgcattgcatcat
caccatggtaacagttcccatcaccatcaccaccaccaccaccatcaccaccaccatgga
caacaagccttgggtaaccggaccaggccaagggtctacaattctccaacgaatagctcc
tctacccaagattctatggaggttggccacagtcaccactccatgacatccctgtcttcc
tcaacgacttcttcctcgacatcttcctcctctactggtaaccaaggcaatcaggcctac
cagaatcgcccagtggctgctaataccttggactttggacagaatggagctatggacgtt
aatttgaccgtctactccaatccccgccaagagactggcatagctggacatccaacatac
caattttctgctaatacaggtcctgcacattacatgactgaaggacatctgacaatgagg
caaggggctgatagagaagagtcccccatgacaggagtttgtgtgcaacagagtcctgta
gctagctcgtga

DBGET integrated database retrieval system