KEGG   Homo sapiens (human): 186Help
Entry
186               CDS       T01001                                 

Gene name
AGTR2, AT2, ATGR2, MRX88
Definition
angiotensin II receptor, type 2
Orthology
K04167  
angiotensin II receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Renin-angiotensin system
Disease
H00480  
Non-syndromic X-linked mental retardation
Drug target
Angiotensinamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    186 (AGTR2)
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    186 (AGTR2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    186 (AGTR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Angiotensin
    186 (AGTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22-q23
AA seq 363 aa AA seqDB search
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcaactccacccttgccactactagcaaaaacattaccagcggtcttcacttc
gggcttgtgaacatctctggcaacaatgagtctaccttgaactgttcacagaaaccatca
gataagcatttagatgcaattcctattctttactacattatatttgtaattggatttctg
gtcaatattgtcgtggttacactgttttgttgtcaaaagggtcctaaaaaggtttctagc
atatacatcttcaacctcgctgtggctgatttactccttttggctactcttcctctatgg
gcaacctattattcttatagatatgactggctctttggacctgtgatgtgcaaagttttt
ggttcttttcttaccctgaacatgtttgcaagcattttttttatcacctgcatgagtgtt
gataggtaccaatctgtcatctacccctttctgtctcaaagaagaaatccctggcaagca
tcttatatagttccccttgtttggtgtatggcctgtttgtcctcattgccaacattttat
tttcgagacgtcagaaccattgaatacttaggagtgaatgcttgcattatggctttccca
cctgagaaatatgcccaatggtcagctgggattgccttaatgaaaaatatccttggtttt
attatccctttaatattcatagcaacatgctattttggaattagaaaacacttactgaag
acgaatagctatgggaagaacaggataacccgtgaccaagtcctgaagatggcagctgct
gttgttctggccttcatcatttgctggcttcccttccatgttctgaccttcctggatgct
ctggcctggatgggtgtcattaatagctgcgaagttatagcagtcattgacctggcactt
ccttttgccatcctcttgggattcaccaacagctgcgttaatccgtttctgtattgtttt
gttggaaaccggttccaacagaagctccgcagtgtgtttagggttccaattacttggctc
caagggaaaagagagagtatgtcttgccggaaaagcagttctcttagagaaatggagacc
tttgtgtcttaa

DBGET integrated database retrieval system