KEGG   Homo sapiens (human): 187Help
Entry
187               CDS       T01001                                 

Gene name
APLNR, AGTRL1, APJ, APJR, HG11
Definition
apelin receptor
Orthology
K04174  
apelin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    187 (APLNR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Gut peptide
   Apelin
    187 (APLNR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12
AA seq 380 aa AA seqDB search
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK
RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL
TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ
CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL
RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV
NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK
GGEQMHEKSIPYSQETLVVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggtggtgattttgacaactactatggggcagacaaccagtctgagtgtgag
tacacagactggaaatcctcgggggccctcatccctgccatctacatgttggtcttcctc
ctgggcaccacgggcaacggtctggtgctctggaccgtgtttcggagcagccgggagaag
aggcgctcagctgatatcttcattgctagcctggcggtggctgacctgaccttcgtggtg
acgctgcccctgtgggctacctacacgtaccgggactatgactggccctttgggaccttc
ttctgcaagctcagcagctacctcatcttcgtcaacatgtacgccagcgtcttctgcctc
accggcctcagcttcgaccgctacctggccatcgtgaggccagtggccaatgctcggctg
aggctgcgggtcagcggggccgtggccacggcagttctttgggtgctggccgccctcctg
gccatgcctgtcatggtgttacgcaccaccggggacttggagaacaccactaaggtgcag
tgctacatggactactccatggtggccactgtgagctcagagtgggcctgggaggtgggc
cttggggtctcgtccaccaccgtgggctttgtggtgcccttcaccatcatgctgacctgt
tacttcttcatcgcccaaaccatcgctggccacttccgcaaggaacgcatcgagggcctg
cggaagcggcgccggctgctcagcatcatcgtggtgctggtggtgacctttgccctgtgc
tggatgccctaccacctggtgaagacgctgtacatgctgggcagcctgctgcactggccc
tgtgactttgacctcttcctcatgaacatcttcccctactgcacctgcatcagctacgtc
aacagctgcctcaaccccttcctctatgcctttttcgacccccgcttccgccaggcctgc
acctccatgctctgctgtggccagagcaggtgcgcaggcacctcccacagcagcagtggg
gagaagtcagccagctactcttcggggcacagccaggggcccggccccaacatgggcaag
ggtggagaacagatgcacgagaaatccatcccctacagccaggagacccttgtggttgac
tag

DBGET integrated database retrieval system