KEGG   Homo sapiens (human): 187Help
Entry
187               CDS       T01001                                 

Gene name
APLNR, AGTRL1, APJ, APJR, HG11
Definition
(RefSeq) apelin receptor
  KO
K04174  apelin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    187 (APLNR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    187 (APLNR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Gut peptide
   Apelin
    187 (APLNR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srv TAS2R
Motif
Other DBs
NCBI-GeneID: 187
NCBI-ProteinID: NP_005152
OMIM: 600052
HGNC: 339
Ensembl: ENSG00000134817
Vega: OTTHUMG00000167021
Pharos: P35414(Tchem)
UniProt: P35414 B3KQN4 B2RDH3
Structure
PDB: 

Jmol
Position
11q12.1
AA seq 380 aa AA seqDB search
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK
RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL
TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ
CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL
RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV
NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK
GGEQMHEKSIPYSQETLVVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggtggtgattttgacaactactatggggcagacaaccagtctgagtgtgag
tacacagactggaaatcctcgggggccctcatccctgccatctacatgttggtcttcctc
ctgggcaccacgggcaacggtctggtgctctggaccgtgtttcggagcagccgggagaag
aggcgctcagctgatatcttcattgctagcctggcggtggctgacctgaccttcgtggtg
acgctgcccctgtgggctacctacacgtaccgggactatgactggccctttgggaccttc
ttctgcaagctcagcagctacctcatcttcgtcaacatgtacgccagcgtcttctgcctc
accggcctcagcttcgaccgctacctggccatcgtgaggccagtggccaatgctcggctg
aggctgcgggtcagcggggccgtggccacggcagttctttgggtgctggccgccctcctg
gccatgcctgtcatggtgttacgcaccaccggggacttggagaacaccactaaggtgcag
tgctacatggactactccatggtggccactgtgagctcagagtgggcctgggaggtgggc
cttggggtctcgtccaccaccgtgggctttgtggtgcccttcaccatcatgctgacctgt
tacttcttcatcgcccaaaccatcgctggccacttccgcaaggaacgcatcgagggcctg
cggaagcggcgccggctgctcagcatcatcgtggtgctggtggtgacctttgccctgtgc
tggatgccctaccacctggtgaagacgctgtacatgctgggcagcctgctgcactggccc
tgtgactttgacctcttcctcatgaacatcttcccctactgcacctgcatcagctacgtc
aacagctgcctcaaccccttcctctatgcctttttcgacccccgcttccgccaggcctgc
acctccatgctctgctgtggccagagcaggtgcgcaggcacctcccacagcagcagtggg
gagaagtcagccagctactcttcggggcacagccaggggcccggccccaacatgggcaag
ggtggagaacagatgcacgagaaatccatcccctacagccaggagacccttgtggttgac
tag

DBGET integrated database retrieval system