KEGG   Homo sapiens (human): 1870Help
Entry
1870              CDS       T01001                                 

Gene name
E2F2, E2F-2
Definition
E2F transcription factor 2
Orthology
K09389  
transcription factor E2F2
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Hepatitis B
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1870 (E2F2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1870 (E2F2)
   05206 MicroRNAs in cancer
    1870 (E2F2)
   05212 Pancreatic cancer
    1870 (E2F2)
   05214 Glioma
    1870 (E2F2)
   05220 Chronic myeloid leukemia
    1870 (E2F2)
   05218 Melanoma
    1870 (E2F2)
   05219 Bladder cancer
    1870 (E2F2)
   05215 Prostate cancer
    1870 (E2F2)
   05222 Small cell lung cancer
    1870 (E2F2)
   05223 Non-small cell lung cancer
    1870 (E2F2)
  Infectious diseases
   05166 HTLV-I infection
    1870 (E2F2)
   05161 Hepatitis B
    1870 (E2F2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    1870 (E2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36
AA seq 437 aa AA seqDB search
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggcttcggccgctgggcagaccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actgctacctactacacaccgctgtacccgcagacggcgcctcccgcagcggcgccaggc
acctgcctcgacgccactccccacggacccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgtcgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacttcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggaaggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccaccagacctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacacg
gagcaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgttggcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcctctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcaccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcctgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcgtgcagctcccctctg
atcagcttctccccatccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgatctcttcgactcctacgaccttggggacctgttgattaattga

DBGET integrated database retrieval system