KEGG   Homo sapiens (human): 1870Help
Entry
1870              CDS       T01001                                 

Gene name
E2F2, E2F-2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04934  Cushing's syndrome
hsa05161  Hepatitis B
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00692  Cell cycle - G1/S transition
Network
N00066  p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00074  Loss of RB1 to cell cycle G1/S
N00075  Mutation-inactivated RB1 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00167  KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  KSHV vCyclin to cell cycle G1/S
N00169  KSHV LANA to p21-cell cycle G1/S
N00170  KSHV LANA to cell cycle G1/S
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00255  Amplified CCNE to cell cycle G1/S
N00275  Amplified CCND1 to cell cycle G1/S
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1870 (E2F2)
   04218 Cellular senescence
    1870 (E2F2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1870 (E2F2)
   05206 MicroRNAs in cancer
    1870 (E2F2)
   05212 Pancreatic cancer
    1870 (E2F2)
   05225 Hepatocellular carcinoma
    1870 (E2F2)
   05226 Gastric cancer
    1870 (E2F2)
   05214 Glioma
    1870 (E2F2)
   05220 Chronic myeloid leukemia
    1870 (E2F2)
   05218 Melanoma
    1870 (E2F2)
   05219 Bladder cancer
    1870 (E2F2)
   05215 Prostate cancer
    1870 (E2F2)
   05224 Breast cancer
    1870 (E2F2)
   05222 Small cell lung cancer
    1870 (E2F2)
   05223 Non-small cell lung cancer
    1870 (E2F2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    1870 (E2F2)
  Infectious diseases
   05166 HTLV-I infection
    1870 (E2F2)
   05161 Hepatitis B
    1870 (E2F2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1870 (E2F2)
  Drug resistance
   01522 Endocrine resistance
    1870 (E2F2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    1870 (E2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 1870
NCBI-ProteinID: NP_004082
OMIM: 600426
HGNC: 3114
Ensembl: ENSG00000007968
Vega: OTTHUMG00000003223
Pharos: Q14209(Tbio)
UniProt: Q14209
Position
1p36.12
AA seq 437 aa AA seqDB search
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggcttcggccgctgggcagaccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actgctacctactacacaccgctgtacccgcagacggcgcctcccgcagcggcgccaggc
acctgcctcgacgccactccccacggacccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgtcgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacttcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggaaggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccaccagacctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacacg
gagcaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgttggcaac
tttaaggagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcctctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcaccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcctgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcgtgcagctcccctctg
atcagcttctccccatccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgatctcttcgactcctacgaccttggggacctgttgattaattga

DBGET integrated database retrieval system