KEGG   Homo sapiens (human): 1871Help
Entry
1871              CDS       T01001                                 

Gene name
E2F3, E2F-3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  
transcription factor E2F3
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Cell cycle
Cellular senescence
Hepatitis B
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Module
Cell cycle - G1/S transition
Network
N00066  
p21-Cell cycle G1/S
N00067  
Deleted p14(ARF) to p21-cell cycle G1/S
N00068  
Amplified MDM2 to p21-cell cycle G1/S
N00069  
p16-Cell cycle G1/S
N00070  
Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  
Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  
Amplified CDK4 to cell cycle G1/S
N00073  
Mutation-activated CDK4 to cell cycle G1/S
N00074  
Loss of RB1 to cell cycle G1/S
N00075  
Mutation-inactivated RB1 to cell cycle G1/S
N00076  
Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  
Amplified MYC to p15-cell cycle G1/S
N00089  
Amplified MYC to cell cycle G1/S
N00090  
p15-Cell cycle G1/S
N00091  
p27-Cell cycle G1/S
N00092  
Amplified MYC to p27-cell cycle G1/S
N00093  
Loss of CDKN1B to p27-cell cycle G1/S
N00167  
KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  
KSHV vCyclin to cell cycle G1/S
N00169  
KSHV LANA to p21-cell cycle G1/S
N00170  
KSHV LANA to cell cycle G1/S
N00254  
CDKN1B-reduced expression to p27-cell cycle G1/S
N00255  
Amplified CCNE to cell cycle G1/S
N00275  
Amplified CCND1 to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1871 (E2F3)
   04218 Cellular senescence
    1871 (E2F3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1871 (E2F3)
   05206 MicroRNAs in cancer
    1871 (E2F3)
   05212 Pancreatic cancer
    1871 (E2F3)
   05225 Hepatocellular carcinoma
    1871 (E2F3)
   05226 Gastric cancer
    1871 (E2F3)
   05214 Glioma
    1871 (E2F3)
   05220 Chronic myeloid leukemia
    1871 (E2F3)
   05218 Melanoma
    1871 (E2F3)
   05219 Bladder cancer
    1871 (E2F3)
   05215 Prostate cancer
    1871 (E2F3)
   05224 Breast cancer
    1871 (E2F3)
   05222 Small cell lung cancer
    1871 (E2F3)
   05223 Non-small cell lung cancer
    1871 (E2F3)
  Infectious diseases
   05166 HTLV-I infection
    1871 (E2F3)
   05161 Hepatitis B
    1871 (E2F3)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1871 (E2F3)
  Drug resistance
   01522 Endocrine resistance
    1871 (E2F3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    1871 (E2F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O00716(Tbio)
UniProt: 
Position
6p22.3
AA seq 465 aa AA seqDB search
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQI
LTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALG
RGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYD
TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ
WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT
YQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSP
MKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEG
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagggaatccagcccgctctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttcgccgccgccgccgccgctgccgccgccccgggcgcgtacatccagatc
ctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggcgccgtagcc
gccggccccctcctccccagtgcccccggcgcggagcagaccgccggcagcctcctctac
accacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagcgctggga
cgcggcggcagcggcggcggcggcggccctccggcaaagcgaaggctggagctaggagaa
agcggtcatcagtacctctcagatggtttaaaaacccccaagggcaaaggaagagctgca
ctacgaagtccagatagtccaaaaactccaaaatctccctcagaaaaaacgcggtatgat
acgtctcttggtctgctcaccaagaagttcattcagctcctgagccagtcacccgatggg
gtattggatttgaacaaggcagcagaagtgctaaaagtgcaaaagagaaggatttatgat
atcaccaacgttctggaaggcatccacctcattaagaagaagtctaaaaacaacgtccaa
tggatgggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtca
aaagaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgc
accctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttaca
tatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcc
cctccagaaacaagacttgaagtgcctgactcaatagagagcctacaaatacatttggca
agtacccaagggcccattgaggtttacttatgtccagaagagactgaaacacacagtcca
atgaaaacaaacaaccaagaccacaatgggaatatccctaaacccgcttccaaagacttg
gcttcaaccaactcaggacatagcgattgctcagtttctatgggaaacctttctcctctg
gcctccccagccaacctcttacagcagactgaggaccaaattccttccaacctagaagga
ccgtttgtgaacttactgcctcccctgctgcaagaggactatctcctgagcctcggggag
gaggaaggcatcagcgatctcttcgatgcttacgatttggaaaagctcccactggtggaa
gacttcatgtgtagttga

DBGET integrated database retrieval system