KEGG   Homo sapiens (human): 1871Help
Entry
1871              CDS       T01001                                 

Gene name
E2F3, E2F-3
Definition
E2F transcription factor 3
Orthology
K06620  
transcription factor E2F3
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Hepatitis B
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22
AA seq 334 aa AA seqDB search
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKKKTRYDTSLGLLTKKFI
QLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGG
MLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLK
DQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGN
IPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ
EDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctaggagaaagcggtcatcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactacgaagtccagat
agtccaaaaaaaaaaacgcggtatgatacgtctcttggtctgctcaccaagaagttcatt
cagctcctgagccagtcacccgatggggtattggatttgaacaaggcagcagaagtgcta
aaagtgcaaaagagaaggatttatgatatcaccaacgttctggaaggcatccacctcatt
aagaagaagtctaaaaacaacgtccaatggatgggctgcagtctgtctgaggatgggggc
atgctggcccagtgtcaaggcctgtcaaaagaagtgaccgagctcagtcaggaagagaag
aaattagatgaactgatccaaagctgcaccctggacctcaaactgttaaccgaggattca
gagaatcaaaggttagcttatgttacatatcaagatattcgaaaaattagtggccttaaa
gaccaaactgttatagttgtgaaagcccctccagaaacaagacttgaagtgcctgactca
atagagagcctacaaatacatttggcaagtacccaagggcccattgaggtttacttatgt
ccagaagagactgaaacacacagtccaatgaaaacaaacaaccaagaccacaatgggaat
atccctaaacccgcttccaaagacttggcttcaaccaactcaggacatagcgattgctca
gtttctatgggaaacctttctcctctggcctccccagccaacctcttacagcagactgag
gaccaaattccttccaacctagaaggaccgtttgtgaacttactgcctcccctgctgcaa
gaggactatctcctgagcctcggggaggaggaaggcatcagcgatctcttcgatgcttac
gatttggaaaagctcccactggtggaagacttcatgtgtagttga

DBGET integrated database retrieval system