KEGG   Homo sapiens (human): 1876Help
Entry
1876              CDS       T01001                                 

Gene name
E2F6, E2F-6
Definition
(RefSeq) E2F transcription factor 6
  KO
K09390  
transcription factor E2F6
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    1876 (E2F6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25.1
AA seq 281 aa AA seqDB search
MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVK
RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS
KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERL
AYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ
GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcagcggccggcgaggaagttacccagtctcctcctggacccgacggaggag
acggttcgccgtcggtgccgagaccccatcaacgtggagggcctgctgccatcaaaaata
aggattaatttagaagataatgtacaatatgtgtccatgagaaaagctctaaaagtgaag
agacctcgttttgatgtatcgctggtttatttaactcgaaaatttatggatcttgtcaga
tctgctcccgggggtattcttgacttaaacaaggttgcaacgaaactgggagtccgaaag
cggagagtgtatgacatcaccaatgtcttagatggaatcgacctcgttgaaaagaaatcc
aagaaccatattagatggataggatctgatcttagcaattttggagcagttccccaacaa
aagaagctacaggaggaactttctgacttatcagcaatggaagatgctttggatgagtta
attaaggattgtgctcagcagctgtttgagttaacagatgacaaagaaaatgaaagacta
gcatatgtgacctatcaagacattcatagcattcaggccttccatgaacagatcgtcatt
gcagttaaagctccagcagaaaccagattggatgttccagctcccagagaagactctatc
acagtgcacataaggagcaccaacggacctatcgatgtctatttgtgtgaagtggagcag
ggtcagaccagtaacaaaaggtctgaaggtgtcgggacctcttcatctgagagcactcat
ccagaaggccctgaggaagaagaaaatcctcagcaaagtgaagaattgcttgaagtaagc
aactga

DBGET integrated database retrieval system