KEGG   Homo sapiens (human): 1896Help
Entry
1896              CDS       T01001                                 

Gene name
EDA, ECTD1, ED1, ED1-A1, ED1-A2, EDA-A1, EDA-A2, EDA1, EDA2, HED, HED1, ODT1, STHAGX1, XHED, XLHED
Definition
ectodysplasin A
Orthology
K05480  
ectodysplasin-A
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Disease
H00625  
Tooth agenesis
H00651  
Ectodermal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1896 (EDA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq12-q13.1
AA seq 389 aa AA seqDB search
MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCC
YLELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGE
AALHSDSQDGHQMALLNFFFPDEKPYSEEESRRVRRNKRSKSNEGADGPVKNKKKGKKAG
PPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK
AGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGT
YFIYSQVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAV
KMVHADISINMSKHTTFFGAIRLGEAPAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggctacccggaggtggagcgcagggaactcctgcctgcagcagcgccgcgggagcga
gggagccagggctgcgggtgtggcggggcccctgcccgggcgggcgaagggaacagctgc
ctgctcttcctgggtttctttggcctctcgctggccctccacctgctgacgttgtgctgc
tacctagagttgcgctcggagttgcggcgggaacgtggagccgagtcccgccttggcggc
tcgggcacccctggcacctctggcaccctaagcagcctcggtggcctcgaccctgacagc
cccatcaccagtcaccttgggcagccgtcacctaagcagcagccattggaaccgggagaa
gccgcactccactctgactcccaggacgggcaccagatggccctattgaatttcttcttc
cctgatgaaaagccatactctgaagaagaaagtaggcgtgttcgccgcaataaaagaagc
aaaagcaatgaaggagcagatggcccagttaaaaacaagaaaaagggaaagaaagcagga
cctcctggacccaatggccctccaggacccccaggacctccaggaccccagggaccccca
ggaattccagggattcctggaattccaggaacaactgttatgggaccacctggtcctcca
ggtcctcctggtcctcaaggaccccctggcctccagggaccttctggtgctgctgataaa
gctggaactcgagaaaaccagccagctgtggtgcatctacagggccaagggtcagcaatt
caagtcaagaatgatctttcaggtggagtgctcaatgactggtctcgcatcactatgaac
cccaaggtgtttaagctacatccccgcagcggggagctggaggtactggtggacggcacc
tacttcatctatagtcaggtatactacatcaacttcactgactttgccagctatgaggtg
gtggtggatgagaagcccttcctgcagtgcacacgcagcatcgagacgggcaagaccaac
tacaacacttgctataccgcaggcgtctgcctcctcaaggcccggcagaagatcgccgtc
aagatggtgcacgctgacatctccatcaacatgagcaagcacaccacgttctttggggcc
atcaggctgggtgaagcccctgcatcctag

DBGET integrated database retrieval system