KEGG   Homo sapiens (human): 190Help
Entry
190               CDS       T01001                                 

Gene name
NR0B1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1, SRXY2
Definition
(RefSeq) nuclear receptor subfamily 0 group B member 1
  KO
K08562  
nuclear receptor subfamily 0 group B member 1
Organism
hsa  Homo sapiens (human)
Disease
H00552  
Chromosome Xp21 deletion syndrome
H00607  
46,XY disorders of sex development (Disorders of gonadal development)
H01598  
Addison's disease
H01700  
Hypopituitarism
H01772  
Adrenal hypoplasia congenita, ingluding:
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Knirps/DAX 1-like
    190 (NR0B1)
Nuclear receptors [BR:hsa03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   190 (NR0B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P51843(Tbio)
UniProt: 
Position
Xp21.2
AA seq 470 aa AA seqDB search
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV
ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL
PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR
PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSS
GALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA
QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQA
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQ
GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgagaaccaccagtggcagggcagcatcctctacaacatgcttatgagcgcg
aagcaaacgcgcgcggctcctgaggctccagagacgcggctggtggatcagtgctggggc
tgttcgtgcggcgatgagcccggggtgggcagagaggggctgctgggcgggcggaacgtg
gcgctcctgtaccgctgctgcttttgcggtaaagaccacccacggcagggcagcatcctc
tacagcatgctgacgagcgcaaagcaaacgtacgcggcaccgaaggcgcccgaggcgacg
ctgggtccgtgctggggctgttcgtgcggctctgatcccggggtgggcagagcggggctt
ccgggtgggcggcccgtggcactcctgtaccgctgctgcttttgtggtgaagaccacccg
cggcagggcagcatcctctacagcttgctcactagctcaaagcaaacgcacgtggctccg
gcagcgcccgaggcacggccagggggcgcgtggtgggaccgctcctacttcgcgcagagg
ccagggggtaaagaggcgctaccaggcgggcgggccacggcgcttctgtaccgctgctgc
ttttgcggtgaagaccacccgcagcagggcagcaccctctactgcgtgcccacgagcaca
aatcaagcgcaggcggctccggaggagcggccgagggccccctggtgggacacctcctct
ggtgcgctgcggccggtggcgctcaagagtccacaggtggtctgcgaggcagcctcagcg
ggcctgttgaagacgctgcgcttcgtcaagtacttgccctgcttccaggtgctgcccctg
gaccagcagctggtgctggtgcgcaactgctgggcgtccctgctcatgcttgagctggcc
caggaccgcttgcagttcgagactgtggaagtctcggagcccagcatgctgcagaagatc
ctcaccaccaggcggcgggagaccgggggcaacgagccactgcccgtgcccacgctgcag
caccatttggcaccgccggcggaggccaggaaggtgccctccgcctcccaggtccaagcc
atcaagtgctttctttccaaatgctggagtctgaacatcagtaccaaggagtacgcctac
ctcaaggggaccgtgctctttaacccggacgtgccgggcctgcagtgcgtgaagtacatt
cagggactccagtggggaactcagcaaatactcagtgaacacaccaggatgacgcaccaa
gggccccatgacagattcatcgaacttaatagtacccttttcctgctgagattcatcaat
gccaatgtcattgctgaactgttcttcaggcccatcatcggcacagtcagcatggatgat
atgatgctggaaatgctctgtacaaagatataa

DBGET integrated database retrieval system