KEGG   Homo sapiens (human): 190Help
Entry
190               CDS       T01001                                 

Gene name
NR0B1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1, SRXY2
Definition
nuclear receptor subfamily 0, group B, member 1
Orthology
K08562  
nuclear receptor subfamily 0 group B member 1
Organism
hsa  Homo sapiens (human)
Disease
H00552  
Glycerol kinase deficiency (GKD)
H00607  
46,XY disorders of sex development (Disorders of gonadal development)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Knirps/DAX 1-like
    190 (NR0B1)
Nuclear receptors [BR:hsa03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   190 (NR0B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xp21.3
AA seq 470 aa AA seqDB search
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV
ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL
PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR
PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSS
GALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA
QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQA
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQ
GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgagaaccaccagtggcagggcagcatcctctacaacatgcttatgagcgcg
aagcaaacgcgcgcggctcctgaggctccagagacgcggctggtggatcagtgctggggc
tgttcgtgcggcgatgagcccggggtgggcagagaggggctgctgggcgggcggaacgtg
gcgctcctgtaccgctgctgcttttgcggtaaagaccacccacggcagggcagcatcctc
tacagcatgctgacgagcgcaaagcaaacgtacgcggcaccgaaggcgcccgaggcgacg
ctgggtccgtgctggggctgttcgtgcggctctgatcccggggtgggcagagcggggctt
ccgggtgggcggcccgtggcactcctgtaccgctgctgcttttgtggtgaagaccacccg
cggcagggcagcatcctctacagcttgctcactagctcaaagcaaacgcacgtggctccg
gcagcgcccgaggcacggccagggggcgcgtggtgggaccgctcctacttcgcgcagagg
ccagggggtaaagaggcgctaccaggcgggcgggccacggcgcttctgtaccgctgctgc
ttttgcggtgaagaccacccgcagcagggcagcaccctctactgcgtgcccacgagcaca
aatcaagcgcaggcggctccggaggagcggccgagggccccctggtgggacacctcctct
ggtgcgctgcggccggtggcgctcaagagtccacaggtggtctgcgaggcagcctcagcg
ggcctgttgaagacgctgcgcttcgtcaagtacttgccctgcttccaggtgctgcccctg
gaccagcagctggtgctggtgcgcaactgctgggcgtccctgctcatgcttgagctggcc
caggaccgcttgcagttcgagactgtggaagtctcggagcccagcatgctgcagaagatc
ctcaccaccaggcggcgggagaccgggggcaacgagccactgcccgtgcccacgctgcag
caccatttggcaccgccggcggaggccaggaaggtgccctccgcctcccaggtccaagcc
atcaagtgctttctttccaaatgctggagtctgaacatcagtaccaaggagtacgcctac
ctcaaggggaccgtgctctttaacccggacgtgccgggcctgcagtgcgtgaagtacatt
cagggactccagtggggaactcagcaaatactcagtgaacacaccaggatgacgcaccaa
gggccccatgacagattcatcgaacttaatagtacccttttcctgctgagattcatcaat
gccaatgtcattgctgaactgttcttcaggcccatcatcggcacagtcagcatggatgat
atgatgctggaaatgctctgtacaaagatataa

DBGET integrated database retrieval system