KEGG   Homo sapiens (human): 1901Help
Entry
1901              CDS       T01001                                 

Gene name
S1PR1, CD363, CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, S1P1
Definition
(RefSeq) sphingosine-1-phosphate receptor 1
  KO
K04288  
sphingosine 1-phosphate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Fingolimod [DG:DG00741]: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    1901 (S1PR1)
   04071 Sphingolipid signaling pathway
    1901 (S1PR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1901 (S1PR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Sphingolipid [OT]
    1901 (S1PR1)
Cellular antigens [BR:hsa04090]
 Proteins
  1901 (S1PR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p21
AA seq 382 aa AA seqDB search
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggggcccaccagcgtcccgctggtcaaggcccaccgcagctcggtctctgactacgtc
aactatgatatcatcgtccggcattacaactacacgggaaagctgaatatcagcgcggac
aaggagaacagcattaaactgacctcggtggtgttcattctcatctgctgctttatcatc
ctggagaacatctttgtcttgctgaccatttggaaaaccaagaaattccaccgacccatg
tactattttattggcaatctggccctctcagacctgttggcaggagtagcctacacagct
aacctgctcttgtctggggccaccacctacaagctcactcccgcccagtggtttctgcgg
gaagggagtatgtttgtggccctgtcagcctccgtgttcagtctcctcgccatcgccatt
gagcgctatatcacaatgctgaaaatgaaactccacaacgggagcaataacttccgcctc
ttcctgctaatcagcgcctgctgggtcatctccctcatcctgggtggcctgcctatcatg
ggctggaactgcatcagtgcgctgtccagctgctccaccgtgctgccgctctaccacaag
cactatatcctcttctgcaccacggtcttcactctgcttctgctctccatcgtcattctg
tactgcagaatctactccttggtcaggactcggagccgccgcctgacgttccgcaagaac
atttccaaggccagccgcagctctgagaagtcgctggcgctgctcaagaccgtaattatc
gtcctgagcgtcttcatcgcctgctgggcaccgctcttcatcctgctcctgctggatgtg
ggctgcaaggtgaagacctgtgacatcctcttcagagcggagtacttcctggtgttagct
gtgctcaactccggcaccaaccccatcatttacactctgaccaacaaggagatgcgtcgg
gccttcatccggatcatgtcctgctgcaagtgcccgagcggagactctgctggcaaattc
aagcgacccatcatcgccggcatggaattcagccgcagcaaatcggacaattcctcccac
ccccagaaagacgaaggggacaacccagagaccattatgtcttctggaaacgtcaactct
tcttcctag

DBGET integrated database retrieval system