KEGG   Homo sapiens (human): 1901Help
Entry
1901              CDS       T01001                                 

Gene name
S1PR1, CD363, CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, S1P1
Definition
(RefSeq) sphingosine-1-phosphate receptor 1
  KO
K04288  sphingosine 1-phosphate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Fingolimod (DG00741): D04187 D10001
Ozanimod (DG02827): D10967 D10968
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    1901 (S1PR1)
   04071 Sphingolipid signaling pathway
    1901 (S1PR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1901 (S1PR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Sphingolipid [OT]
    1901 (S1PR1)
CD molecules [BR:hsa04090]
 Proteins
  1901 (S1PR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 JTB
Motif
Other DBs
NCBI-GeneID: 1901
NCBI-ProteinID: NP_001307659
OMIM: 601974
HGNC: 3165
Ensembl: ENSG00000170989
Vega: OTTHUMG00000010835
Pharos: P21453(Tclin)
UniProt: P21453
Position
1p21.2
AA seq 382 aa AA seqDB search
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggggcccaccagcgtcccgctggtcaaggcccaccgcagctcggtctctgactacgtc
aactatgatatcatcgtccggcattacaactacacgggaaagctgaatatcagcgcggac
aaggagaacagcattaaactgacctcggtggtgttcattctcatctgctgctttatcatc
ctggagaacatctttgtcttgctgaccatttggaaaaccaagaaattccaccgacccatg
tactattttattggcaatctggccctctcagacctgttggcaggagtagcctacacagct
aacctgctcttgtctggggccaccacctacaagctcactcccgcccagtggtttctgcgg
gaagggagtatgtttgtggccctgtcagcctccgtgttcagtctcctcgccatcgccatt
gagcgctatatcacaatgctgaaaatgaaactccacaacgggagcaataacttccgcctc
ttcctgctaatcagcgcctgctgggtcatctccctcatcctgggtggcctgcctatcatg
ggctggaactgcatcagtgcgctgtccagctgctccaccgtgctgccgctctaccacaag
cactatatcctcttctgcaccacggtcttcactctgcttctgctctccatcgtcattctg
tactgcagaatctactccttggtcaggactcggagccgccgcctgacgttccgcaagaac
atttccaaggccagccgcagctctgagaagtcgctggcgctgctcaagaccgtaattatc
gtcctgagcgtcttcatcgcctgctgggcaccgctcttcatcctgctcctgctggatgtg
ggctgcaaggtgaagacctgtgacatcctcttcagagcggagtacttcctggtgttagct
gtgctcaactccggcaccaaccccatcatttacactctgaccaacaaggagatgcgtcgg
gccttcatccggatcatgtcctgctgcaagtgcccgagcggagactctgctggcaaattc
aagcgacccatcatcgccggcatggaattcagccgcagcaaatcggacaattcctcccac
ccccagaaagacgaaggggacaacccagagaccattatgtcttctggaaacgtcaactct
tcttcctag

DBGET integrated database retrieval system