KEGG   Homo sapiens (human): 1902Help
Entry
1902              CDS       T01001                                 

Gene name
LPAR1, EDG2, GPR26, Gpcr26, LPA1, Mrec1.3, VZG1, edg-2, rec.1.3, vzg-1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  
lysophosphatidic acid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Gap junction
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1902 (LPAR1)
   04072 Phospholipase D signaling pathway
    1902 (LPAR1)
   04151 PI3K-Akt signaling pathway
    1902 (LPAR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1902 (LPAR1)
 Cellular Processes
  Cellular community
   04540 Gap junction
    1902 (LPAR1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1902 (LPAR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Lysophosphatidic acid [OT]
    1902 (LPAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31.3
AA seq 364 aa AA seqDB search
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatctctacttccatccctgtaatttcacagccccagttcacagccatgaat
gaaccacagtgcttctacaacgagtccattgccttcttttataaccgaagtggaaagcat
cttgccacagaatggaacacagtcagcaagctggtgatgggacttggaatcactgtttgt
atcttcatcatgttggccaacctattggtcatggtggcaatctatgtcaaccgccgcttc
cattttcctatttattacctaatggctaatctggctgctgcagacttctttgctgggttg
gcctacttctatctcatgttcaacacaggacccaatactcggagactgactgttagcaca
tggctccttcgtcagggcctcattgacaccagcctgacggcatctgtggccaacttactg
gctattgcaatcgagaggcacattacggttttccgcatgcagctccacacacggatgagc
aaccggcgggtagtggtggtcattgtggtcatctggactatggccatcgttatgggtgct
atacccagtgtgggctggaactgtatctgtgatattgaaaattgttccaacatggcaccc
ctctacagtgactcttacttagtcttctgggccattttcaacttggtgacctttgtggta
atggtggttctctatgctcacatctttggctatgttcgccagaggactatgagaatgtct
cggcatagttctggaccccggcggaatcgggataccatgatgagtcttctgaagactgtg
gtcattgtgcttggggcctttatcatctgctggactcctggattggttttgttacttcta
gacgtgtgctgtccacagtgcgacgtgctggcctatgagaaattcttccttctccttgct
gaattcaactctgccatgaaccccatcatttactcctaccgcgacaaagaaatgagcgcc
acctttaggcagatcctctgctgccagcgcagtgagaaccccaccggccccacagaaggc
tcagaccgctcggcttcctccctcaaccacaccatcttggctggagttcacagcaatgac
cactctgtggtttag

DBGET integrated database retrieval system