KEGG   Homo sapiens (human): 1909Help
Entry
1909              CDS       T01001                                 

Gene name
EDNRA, ET-A, ETA, ETA-R, ETAR, ETRA, hET-AR
Definition
endothelin receptor type A
Orthology
K04197  
endothelin receptor type A
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Pathways in cancer
Drug target
Bosentan: 
Ambrisentan: 
Sitaxentan: 
Macitentan: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1909 (EDNRA)
   04024 cAMP signaling pathway
    1909 (EDNRA)
   04022 cGMP - PKG signaling pathway
    1909 (EDNRA)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1909 (EDNRA)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    1909 (EDNRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1909 (EDNRA)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin
    1909 (EDNRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q31.22
AA seq 318 aa AA seqDB search
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGS
LRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLL
MDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKN
HDQNNHNTDRSSHKDSMN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt
gataatcctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt
cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ttctaccaagatgtaaaggactggtggctcttcgggttctatttctgtatgcccttggtg
tgcactgcgatcttctacaccctcatgacttgtgagatgttgaacagaaggaatggcagc
ttgagaattgccctcagtgaacatcttaagcagcgtcgagaagtggcaaaaacagttttc
tgcttggttgtaatttttgctctttgctggttccctcttcatttaagccgtatattgaag
aaaactgtgtataacgagatggacaagaaccgatgtgaattacttagtttcttactgctc
atggattacatcggtattaacttggcaaccatgaattcatgtataaaccccatagctctg
tattttgtgagcaagaaatttaaaaattgtttccagtcatgcctctgctgctgctgttac
cagtccaaaagtctgatgacctcggtccccatgaacggaacaagcatccagtggaagaac
cacgatcaaaacaaccacaacacagaccggagcagccataaggacagcatgaactga

DBGET integrated database retrieval system