KEGG   Homo sapiens (human): 1909Help
Entry
1909              CDS       T01001                                 

Gene name
EDNRA, ET-A, ETA, ETA-R, ETAR, ETRA, MFDA, hET-AR
Definition
(RefSeq) endothelin receptor type A
  KO
K04197  
endothelin receptor type A
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Renin secretion
Pathways in cancer
Drug target
Bosentan [DG:DG00266]: 
Ambrisentan: 
Sitaxentan [DG:DG00267]: 
Macitentan: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1909 (EDNRA)
   04024 cAMP signaling pathway
    1909 (EDNRA)
   04022 cGMP - PKG signaling pathway
    1909 (EDNRA)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1909 (EDNRA)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    1909 (EDNRA)
  Circulatory system
   04270 Vascular smooth muscle contraction
    1909 (EDNRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1909 (EDNRA)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin
    1909 (EDNRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q31.22
AA seq 427 aa AA seqDB search
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt
gataatcctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt
cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccttttgatcacaatgactttggcgtatttctttgcaagctg
ttcccctttttgcagaagtcctcggtggggatcaccgtcctcaacctctgcgctcttagt
gttgacaggtacagagcagttgcctcctggagtcgtgttcagggaattgggattcctttg
gtaactgccattgaaattgtctccatctggatcctgtcctttatcctggccattcctgaa
gcgattggcttcgtcatggtaccctttgaatataggggtgaacagcataaaacctgtatg
ctcaatgccacatcaaaattcatggagttctaccaagatgtaaaggactggtggctcttc
gggttctatttctgtatgcccttggtgtgcactgcgatcttctacaccctcatgacttgt
gagatgttgaacagaaggaatggcagcttgagaattgccctcagtgaacatcttaagcag
cgtcgagaagtggcaaaaacagttttctgcttggttgtaatttttgctctttgctggttc
cctcttcatttaagccgtatattgaagaaaactgtgtataacgagatggacaagaaccga
tgtgaattacttagtttcttactgctcatggattacatcggtattaacttggcaaccatg
aattcatgtataaaccccatagctctgtattttgtgagcaagaaatttaaaaattgtttc
cagtcatgcctctgctgctgctgttaccagtccaaaagtctgatgacctcggtccccatg
aacggaacaagcatccagtggaagaaccacgatcaaaacaaccacaacacagaccggagc
agccataaggacagcatgaactga

DBGET integrated database retrieval system