KEGG   Homo sapiens (human): 191Help
Entry
191               CDS       T01001                                 

Gene name
AHCY, SAHH, adoHcyase
Definition
(RefSeq) adenosylhomocysteinase
  KO
K01251  adenosylhomocysteinase [EC:3.3.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00035  Methionine degradation
Disease
H00184  Hypermethioninemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    191 (AHCY)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     191 (AHCY)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     191 (AHCY)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   191 (AHCY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C IlvN TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 191
NCBI-ProteinID: NP_000678
OMIM: 180960
HGNC: 343
Ensembl: ENSG00000101444
Vega: OTTHUMG00000140098
Pharos: P23526(Tchem)
UniProt: P23526
Structure
PDB: 

Jmol
Position
20q11.22
AA seq 432 aa AA seqDB search
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaactgccctacaaagtcgccgacatcggcctggctgcctggggacgcaag
gccctggacattgctgagaacgagatgccgggcctgatgcgtatgcgggagcggtactcg
gcctccaagccactgaagggcgcccgcatcgctggctgcctgcacatgaccgtggagacg
gccgtcctcattgagaccctcgtcaccctgggtgctgaggtgcagtggtccagctgcaac
atcttctccacccaggaccatgcggcggctgccattgccaaggctggcattccggtgtat
gcctggaagggcgaaacggacgaggagtacctgtggtgcattgagcagaccctgtacttc
aaggacgggcccctcaacatgattctggacgacgggggcgacctcaccaacctcatccac
accaagtacccgcagcttctgccaggcatccgaggcatctctgaggagaccacgactggg
gtccacaacctctacaagatgatggccaatgggatcctcaaggtgcctgccatcaatgtc
aatgactccgtcaccaagagcaagtttgacaacctctatggctgccgggagtccctcata
gatggcatcaagcgggccacagatgtgatgattgccggcaaggtagcggtggtagcaggc
tatggtgatgtgggcaagggctgtgcccaggccctgcggggtttcggagcccgcgtcatc
atcaccgagattgaccccatcaacgcactgcaggctgccatggagggctatgaggtgacc
accatggatgaggcctgtcaggagggcaacatctttgtcaccaccacaggctgtattgac
atcatccttggccggcactttgagcagatgaaggatgatgccattgtgtgtaacattgga
cactttgacgtggagatcgatgtcaagtggctcaacgagaacgccgtggagaaggtgaac
atcaagccgcaggtggaccggtatcggttgaagaatgggcgccgcatcatcctgctggcc
gagggtcggctggtcaacctgggttgtgccatgggccaccccagcttcgtgatgagtaac
tccttcaccaaccaggtgatggcgcagatcgagctgtggacccatccagacaagtacccc
gttggggttcatttcctgcccaagaagctggatgaggcagtggctgaagcccacctgggc
aagctgaatgtgaagttgaccaagctaactgagaagcaagcccagtacctgggcatgtcc
tgtgatggccccttcaagccggatcactaccgctactga

DBGET integrated database retrieval system