KEGG   Homo sapiens (human): 191Help
Entry
191               CDS       T01001                                 

Gene name
AHCY, SAHH, adoHcyase
Definition
adenosylhomocysteinase (EC:3.3.1.1)
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine degradation
Disease
H00184  
Hypermethioninemia
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.22
AA seq 432 aa AA seqDB search
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaactgccctacaaagtcgccgacatcggcctggctgcctggggacgcaag
gccctggacattgctgagaacgagatgccgggcctgatgcgtatgcgggagcggtactcg
gcctccaagccactgaagggcgcccgcatcgctggctgcctgcacatgaccgtggagacg
gccgtcctcattgagaccctcgtcaccctgggtgctgaggtgcagtggtccagctgcaac
atcttctccacccaggaccatgcggcggctgccattgccaaggctggcattccggtgtat
gcctggaagggcgaaacggacgaggagtacctgtggtgcattgagcagaccctgtacttc
aaggacgggcccctcaacatgattctggacgacgggggcgacctcaccaacctcatccac
accaagtacccgcagcttctgccaggcatccgaggcatctctgaggagaccacgactggg
gtccacaacctctacaagatgatggccaatgggatcctcaaggtgcctgccatcaatgtc
aatgactccgtcaccaagagcaagtttgacaacctctatggctgccgggagtccctcata
gatggcatcaagcgggccacagatgtgatgattgccggcaaggtagcggtggtagcaggc
tatggtgatgtgggcaagggctgtgcccaggccctgcggggtttcggagcccgcgtcatc
atcaccgagattgaccccatcaacgcactgcaggctgccatggagggctatgaggtgacc
accatggatgaggcctgtcaggagggcaacatctttgtcaccaccacaggctgtattgac
atcatccttggccggcactttgagcagatgaaggatgatgccattgtgtgtaacattgga
cactttgacgtggagatcgatgtcaagtggctcaacgagaacgccgtggagaaggtgaac
atcaagccgcaggtggaccggtatcggttgaagaatgggcgccgcatcatcctgctggcc
gagggtcggctggtcaacctgggttgtgccatgggccaccccagcttcgtgatgagtaac
tccttcaccaaccaggtgatggcgcagatcgagctgtggacccatccagacaagtacccc
gttggggttcatttcctgcccaagaagctggatgaggcagtggctgaagcccacctgggc
aagctgaatgtgaagttgaccaagctaactgagaagcaagcccagtacctgggcatgtcc
tgtgatggccccttcaagccggatcactaccgctactga

DBGET integrated database retrieval system