KEGG   Homo sapiens (human): 1910Help
Entry
1910              CDS       T01001                                 

Gene name
EDNRB, ABCDS, ET-B, ET-BR, ETB, ETBR, ETRB, HSCR, HSCR2, WS4A
Definition
endothelin receptor type B
Orthology
K04198  
endothelin receptor type B
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Melanogenesis
Disease
H00054  
Nasopharyngeal cancer
H00759  
Waardenburg syndrome (WS)
H00823  
ABCD syndrome
H00910  
Hirschsprung disease (HD)
Drug target
Bosentan: 
Sitaxentan: 
Macitentan: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1910 (EDNRB)
   04022 cGMP - PKG signaling pathway
    1910 (EDNRB)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1910 (EDNRB)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    1910 (EDNRB)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin
    1910 (EDNRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q22
AA seq 442 aa AA seqDB search
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcctccaagtctgtgcggacgcgccctggttgcgctggttcttgcctgcggc
ctgtcgcggatctggggagaggagagaggcttcccgcctgacagggccactccgcttttg
caaaccgcagagataatgacgccacccactaagaccttatggcccaagggttccaacgcc
agtctggcgcggtcgttggcacctgcggaggtgcctaaaggagacaggacggcaggatct
ccgccacgcaccatctcccctcccccgtgccaaggacccatcgagatcaaggagactttc
aaatacatcaacacggttgtgtcctgccttgtgttcgtgctggggatcatcgggaactcc
acacttctgagaattatctacaagaacaagtgcatgcgaaacggtcccaatatcttgatc
gccagcttggctctgggagacctgctgcacatcgtcattgacatccctatcaatgtctac
aagctgctggcagaggactggccatttggagctgagatgtgtaagctggtgcctttcata
cagaaagcctccgtgggaatcactgtgctgagtctatgtgctctgagtattgacagatat
cgagctgttgcttcttggagtagaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttgatttgggtggtctctgtggttctggctgtccctgaagccataggtttt
gatataattacgatggactacaaaggaagttatctgcgaatctgcttgcttcatcccgtt
cagaagacagctttcatgcagttttacaagacagcaaaagattggtggctattcagtttc
tatttctgcttgccattggccatcactgcatttttttatacactaatgacctgtgaaatg
ttgagaaagaaaagtggcatgcagattgctttaaatgatcacctaaagcagagacgggaa
gtggccaaaaccgtcttttgcctggtccttgtctttgccctctgctggcttccccttcac
ctcagcaggattctgaagctcactctttataatcagaatgatcccaatagatgtgaactt
ttgagctttctgttggtattggactatattggtatcaacatggcttcactgaattcctgc
attaacccaattgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgc
ttatgctgctggtgccagtcatttgaagaaaaacagtccttggaggaaaagcagtcgtgc
ttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaatacagc
tcatcttga

DBGET integrated database retrieval system