KEGG   Homo sapiens (human): 1910Help
Entry
1910              CDS       T01001                                 

Gene name
EDNRB, ABCDS, ET-B, ET-BR, ETB, ETB1, ETBR, ETRB, HSCR, HSCR2, WS4A
Definition
(RefSeq) endothelin receptor type B
  KO
K04198  endothelin receptor type B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04916  Melanogenesis
hsa04926  Relaxin signaling pathway
hsa05200  Pathways in cancer
Disease
H00054  Nasopharyngeal cancer
H00759  Waardenburg syndrome (WS)
H00823  ABCD syndrome
H00910  Hirschsprung disease (HD)
Drug target
Bosentan (DG00266): D01227 D07538
Macitentan: D10135
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1910 (EDNRB)
   04022 cGMP - PKG signaling pathway
    1910 (EDNRB)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1910 (EDNRB)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    1910 (EDNRB)
   04916 Melanogenesis
    1910 (EDNRB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1910 (EDNRB)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin
    1910 (EDNRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 1910
NCBI-ProteinID: NP_000106
OMIM: 131244
HGNC: 3180
Ensembl: ENSG00000136160
Vega: OTTHUMG00000017111
Pharos: P24530(Tclin)
UniProt: P24530
Structure
PDB: 

Jmol
Position
13q22.3
AA seq 442 aa AA seqDB search
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcctccaagtctgtgcggacgcgccctggttgcgctggttcttgcctgcggc
ctgtcgcggatctggggagaggagagaggcttcccgcctgacagggccactccgcttttg
caaaccgcagagataatgacgccacccactaagaccttatggcccaagggttccaacgcc
agtctggcgcggtcgttggcacctgcggaggtgcctaaaggagacaggacggcaggatct
ccgccacgcaccatctcccctcccccgtgccaaggacccatcgagatcaaggagactttc
aaatacatcaacacggttgtgtcctgccttgtgttcgtgctggggatcatcgggaactcc
acacttctgagaattatctacaagaacaagtgcatgcgaaacggtcccaatatcttgatc
gccagcttggctctgggagacctgctgcacatcgtcattgacatccctatcaatgtctac
aagctgctggcagaggactggccatttggagctgagatgtgtaagctggtgcctttcata
cagaaagcctccgtgggaatcactgtgctgagtctatgtgctctgagtattgacagatat
cgagctgttgcttcttggagtagaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttgatttgggtggtctctgtggttctggctgtccctgaagccataggtttt
gatataattacgatggactacaaaggaagttatctgcgaatctgcttgcttcatcccgtt
cagaagacagctttcatgcagttttacaagacagcaaaagattggtggctattcagtttc
tatttctgcttgccattggccatcactgcatttttttatacactaatgacctgtgaaatg
ttgagaaagaaaagtggcatgcagattgctttaaatgatcacctaaagcagagacgggaa
gtggccaaaaccgtcttttgcctggtccttgtctttgccctctgctggcttccccttcac
ctcagcaggattctgaagctcactctttataatcagaatgatcccaatagatgtgaactt
ttgagctttctgttggtattggactatattggtatcaacatggcttcactgaattcctgc
attaacccaattgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgc
ttatgctgctggtgccagtcatttgaagaaaaacagtccttggaggaaaagcagtcgtgc
ttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaatacagc
tcatcttga

DBGET integrated database retrieval system