KEGG   Homo sapiens (human): 1910Help
Entry
1910              CDS       T01001                                 

Gene name
EDNRB, ABCDS, ET-B, ET-BR, ETB, ETBR, ETRB, HSCR, HSCR2, WS4A
Definition
endothelin receptor type B
Orthology
K04198  
endothelin receptor type B
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Melanogenesis
Disease
H00054  
Nasopharyngeal cancer
H00759  
Waardenburg syndrome (WS)
H00823  
ABCD syndrome
H00910  
Hirschsprung disease (HD)
Drug target
Bosentan: 
Sitaxentan: 
Macitentan: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q22
AA seq 442 aa AA seqDB search
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcctccaagtctgtgcggacgcgccctggttgcgctggttcttgcctgcggc
ctgtcgcggatctggggagaggagagaggcttcccgcctgacagggccactccgcttttg
caaaccgcagagataatgacgccacccactaagaccttatggcccaagggttccaacgcc
agtctggcgcggtcgttggcacctgcggaggtgcctaaaggagacaggacggcaggatct
ccgccacgcaccatctcccctcccccgtgccaaggacccatcgagatcaaggagactttc
aaatacatcaacacggttgtgtcctgccttgtgttcgtgctggggatcatcgggaactcc
acacttctgagaattatctacaagaacaagtgcatgcgaaacggtcccaatatcttgatc
gccagcttggctctgggagacctgctgcacatcgtcattgacatccctatcaatgtctac
aagctgctggcagaggactggccatttggagctgagatgtgtaagctggtgcctttcata
cagaaagcctccgtgggaatcactgtgctgagtctatgtgctctgagtattgacagatat
cgagctgttgcttcttggagtagaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttgatttgggtggtctctgtggttctggctgtccctgaagccataggtttt
gatataattacgatggactacaaaggaagttatctgcgaatctgcttgcttcatcccgtt
cagaagacagctttcatgcagttttacaagacagcaaaagattggtggctattcagtttc
tatttctgcttgccattggccatcactgcatttttttatacactaatgacctgtgaaatg
ttgagaaagaaaagtggcatgcagattgctttaaatgatcacctaaagcagagacgggaa
gtggccaaaaccgtcttttgcctggtccttgtctttgccctctgctggcttccccttcac
ctcagcaggattctgaagctcactctttataatcagaatgatcccaatagatgtgaactt
ttgagctttctgttggtattggactatattggtatcaacatggcttcactgaattcctgc
attaacccaattgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgc
ttatgctgctggtgccagtcatttgaagaaaaacagtccttggaggaaaagcagtcgtgc
ttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaatacagc
tcatcttga

DBGET integrated database retrieval system