KEGG   Homo sapiens (human): 192669Help
Entry
192669            CDS       T01001                                 

Gene name
AGO3, EIF2C3
Definition
(RefSeq) argonaute 3, RISC catalytic component
  KO
K11593  
eukaryotic translation initiation factor 2C
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     192669 (AGO3)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    192669 (AGO3)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     192669 (AGO3)
   microRNA pathway
    RISC loading complex
     192669 (AGO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34
AA seq 860 aa AA seqDB search
MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPR
RVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRP
FKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGR
SFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLD
IHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCNVTRRPASHQTFPLQLE
NGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDN
QTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISK
DAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTL
LGMATQCVQVKNVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIQDLASMVRELLIQFYKSTRF
KPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCAD
RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADEL
QLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP
QALAKAVQIHQDTLRTMYFA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcggctccgcaggacccgctggggcccagcccctactcatggtgcccagaaga
cctggctatggcaccatgggcaaacccattaaactgctggctaactgttttcaagttgaa
atcccaaagattgatgtctacctctatgaggtagatattaaaccagacaagtgtcctagg
agagtgaacagggaggtggttgactcaatggttcagcattttaaagtaactatatttgga
gaccgtagaccagtttatgatggaaaaagaagtctttacaccgccaatccacttcctgtg
gcaactacaggggtagatttagacgttactttacctggggaaggtggaaaagatcgacct
ttcaaggtgtcaatcaaatttgtctctcgggtgagttggcacctactgcatgaagtactg
acaggacggaccttgcctgagccactggaattagacaagccaatcagcactaaccctgtc
catgccgttgatgtggtgctacgacatctgccctccatgaaatacacacctgtggggcgt
tcatttttctccgctccagaaggatatgaccaccctctgggagggggcagggaagtgtgg
tttggattccatcagtctgttcggcctgccatgtggaaaatgatgcttaatatcgatgtt
tctgccactgccttctacaaagcacaacctgtaattcagttcatgtgtgaagttcttgat
attcataatattgatgagcaaccaagacctctgactgattctcatcgggtaaaattcacc
aaagagataaaaggtttgaaggttgaagtgactcattgtggaacaatgagacggaaatac
cgtgtttgtaatgtaacaaggaggcctgccagtcatcaaacctttcctttacagttagaa
aacggccaaactgtggagagaacagtagcgcagtatttcagagaaaagtatactcttcag
ctgaagtacccgcaccttccctgtctgcaagtcgggcaggaacagaaacacacctacctg
ccactagaagtctgtaatattgtggcagggcaacgatgtatcaagaagctaacagacaat
cagacttccactatgatcaaggcaacagcaagatctgcaccagatagacaagaggaaatt
agcagattggtaagaagtgcaaattatgaaacagatccatttgttcaggagtttcaattt
aaagttcgggatgaaatggctcatgtaactggacgcgtacttccagcacctatgctccag
tatggaggacggaatcggacagtagcaacaccgagccatggagtatgggacatgcgaggg
aaacaattccacacaggagttgaaatcaaaatgtgggctatcgcttgttttgccacacag
aggcagtgcagagaagaaatattgaagggtttcacagaccagctgcgtaagatttctaag
gatgcagggatgcccatccagggccagccatgcttctgcaaatatgcacagggggcagac
agcgtagagcccatgttccggcatctcaagaacacatattctggcctacagcttattatc
gtcatcctgccggggaagacaccagtgtatgcggaagtgaaacgtgtaggagacacactt
ttgggtatggctacacaatgtgttcaagtcaagaatgtaataaaaacatctcctcaaact
ctgtcaaacttgtgcctaaagataaatgttaaactcggagggatcaataatattcttgta
cctcatcaaagaccttctgtgttccagcaaccagtgatctttttgggagccgatgtcact
catccacctgctggtgatggaaagaagccttctattgctgctgttgtaggtagtatggat
gcacacccaagcagatactgtgccacagtaagagttcagagaccccgacaggagatcatc
caggacttggcctccatggtccgggaacttcttattcaattttataagtcaactcggttc
aagcctactcgtatcatcttttatcgggatggtgtttcagaggggcagtttaggcaggta
ttatattatgaactactagcaattcgagaagcctgcatcagtttggagaaagactatcaa
cctggaataacctacattgtagttcagaagagacatcacactcgattattttgtgctgat
aggacagaaagggttggaagaagtggcaatatcccagctggaacaacagttgatacagac
attacacacccatatgagttcgatttttacctctgtagccatgctggaatacagggtacc
agtcgtccttcacactatcatgttttatgggatgataactgctttactgcagatgaactt
cagctgctaacttaccagctctgccacacttacgtacgctgtacacgatctgtttctata
cctgcaccagcgtattatgctcacctggtagcatttagagccagatatcatcttgtggac
aaagaacatgacagtgctgaaggaagtcacgtttcaggacaaagcaatgggcgagatcca
caagctcttgccaaggctgtacagattcaccaagataccttacgcacaatgtacttcgct
taa

DBGET integrated database retrieval system