KEGG   Homo sapiens (human): 1938Help
Entry
1938              CDS       T01001                                 

Gene name
EEF2, EEF-2, EF-2, EF2, SCA26
Definition
(RefSeq) eukaryotic translation elongation factor 2
  KO
K03234  
elongation factor 2
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    1938 (EEF2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    1938 (EEF2)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Elongation factors
   1938 (EEF2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1938 (EEF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 858 aa AA seqDB search
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG
EGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV
FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN
ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP
MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK
RKGLKEGIPALDNFLDKL
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacttcacggtagaccagatccgcgccatcatggacaagaaggccaacatccgc
aacatgtctgtcatcgcccacgtggaccatggcaagtccacgctgacagactccctggtg
tgcaaggcgggcatcatcgcctcggcccgggccggggagacacgcttcactgatacccgg
aaggacgagcaggagcgttgcatcaccatcaagtcaactgccatctccctcttctacgag
ctctcggagaatgacttgaacttcatcaagcagagcaaggacggtgccggcttcctcatc
aacctcattgactcccccgggcatgtcgacttctcctcggaggtgactgctgccctccga
gtcaccgatggcgcattggtggtggtggactgcgtgtcaggcgtgtgcgtgcagacggag
acagtgctgcggcaggccattgccgagcgcatcaagcctgtgctgatgatgaacaagatg
gaccgcgccctgctggagctgcagctggagcccgaggagctctaccagactttccagcgc
atcgtggagaacgtgaacgtcatcatctccacctacggcgagggcgagagcggccccatg
ggcaacatcatgatcgatcctgtcctcggtaccgtgggctttgggtctggcctccacggg
tgggccttcaccctgaagcagtttgccgagatgtatgtggccaagttcgccgccaagggg
gagggccagttggggcctgccgagcgggccaagaaagtagaggacatgatgaagaagctg
tggggtgacaggtactttgacccagccaacggcaagttcagcaagtcagccaccagcccc
gaagggaagaagctgccacgcaccttctgccagctgatcctggaccccatcttcaaggtg
tttgatgcgatcatgaatttcaagaaagaggagacagcaaaactgatagagaaactggac
atcaaactggacagcgaggacaaggacaaagaaggcaaacccctgctgaaggctgtgatg
cgccgctggctgcctgccggagacgccttgttgcagatgatcaccatccacctgccctcc
cctgtgacggcccagaagtaccgctgcgagctcctgtacgaggggcccccggacgacgag
gctgccatgggcattaaaagctgtgaccccaaaggccctcttatgatgtatatttccaaa
atggtgccaacctccgacaaaggtcggttctacgcctttggacgagtcttctcggggctg
gtctccactggcctgaaggtcaggatcatggggcccaactatacccctgggaagaaggag
gacctctacctgaagccaatccagagaacaatcttgatgatgggccgctacgtggagccc
atcgaggatgtgccttgtgggaacattgtgggcctcgtgggcgtggaccagttcctggtg
aagacgggcaccatcaccaccttcgagcacgcgcacaacatgcgggtgatgaagttcagc
gtcagccctgttgtcagagtggccgtggaggccaagaacccggctgacctgcccaagctg
gtggaggggctgaagcggctggccaagtccgaccccatggtgcagtgcatcatcgaggag
tcgggagagcatatcatcgcgggcgccggcgagctgcacctggagatctgcctgaaggac
ctggaggaggaccacgcctgcatccccatcaagaaatctgacccggtcgtctcgtaccgc
gagacggtcagtgaagagtcgaacgtgctctgcctctccaagtcccccaacaagcacaac
cggctgtacatgaaggcgcggcccttccccgacggcctggccgaggacatcgataaaggc
gaggtgtccgcccgtcaggagctcaagcagcgggcgcgctacctggccgagaagtacgag
tgggacgtggctgaggcccgcaagatctggtgctttgggcccgacggcaccggccccaac
atcctcaccgacatcaccaagggtgtgcagtacctcaacgagatcaaggacagtgtggtg
gccggcttccagtgggccaccaaggagggcgcactgtgtgaggagaacatgcggggtgtg
cgcttcgacgtccacgacgtcaccctgcacgccgacgccatccaccgcggagggggccag
atcatccccacagcacggcgctgcctctatgccagtgtgctgaccgcccagccacgcctc
atggagcccatctaccttgtggagatccagtgtccagagcaggtggtcggtggcatctac
ggggttttgaacaggaagcggggccacgtgttcgaggagtcccaggtggccggcaccccc
atgtttgtggtcaaggcctatctgcccgtcaacgagtcctttggcttcaccgctgacctg
aggtccaacacgggcggccaggcgttcccccagtgtgtgtttgaccactggcagatcctg
cccggagaccccttcgacaacagcagccgccccagccaggtggtggcggagacccgcaag
cgcaagggcctgaaagaaggcatccctgccctggacaacttcctggacaaattgtag

DBGET integrated database retrieval system