KEGG   Homo sapiens (human): 1946Help
Entry
1946              CDS       T01001                                 

Gene name
EFNA5, AF1, EFL5, EPLG7, GLC1M, LERK7, RAGS
Definition
(RefSeq) ephrin A5
  KO
K05462  
ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1946 (EFNA5)
   04015 Rap1 signaling pathway
    1946 (EFNA5)
   04151 PI3K-Akt signaling pathway
    1946 (EFNA5)
 Organismal Systems
  Development
   04360 Axon guidance
    1946 (EFNA5)
Cytokines [BR:hsa04052]
 PDGF family
  Other growth factors
   1946 (EFNA5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  EPHA1, EPH; Eph receptor A1 [KO:K05102]
   1946 (EFNA5)
  EPHA2, ECK; Eph receptor A2 [KO:K05103]
   1946 (EFNA5)
  EPHA3, HEK, TYRO4; Eph receptor A3 [KO:K05104]
   1946 (EFNA5)
  EPHA4, SEK, TYRO1; Eph receptor A4 [KO:K05105]
   1946 (EFNA5)
  EPHA5, EHK1, TYRO4; Eph receptor A5 [KO:K05106]
   1946 (EFNA5)
  EPHA6, EHK2; Eph receptor A6 [KO:K05107]
   1946 (EFNA5)
  EPHA7, EHK3, HEK11; EphA7 [KO:K05108]
   1946 (EFNA5)
  EPHA8, EEK; Eph receptor A8 [KO:K05109]
   1946 (EFNA5)
  EPHA10; Eph receptor A10 [KO:K08897]
   1946 (EFNA5)
  EPHB2, ERK, DRT; Eph receptor B2 [KO:K05111]
   1946 (EFNA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Axon guidance molecules
   1946 (EFNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P52803(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q21.3
AA seq 228 aa AA seqDB search
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctggtgtttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaggccgtcgccgaccgctacgctgtctactggaacagcagcaac
cccagattccagaggggtgactaccatattgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactccgtcccagaagataagactgagcgctatgtcctctac
atggtgaactttgatggctacagtgcctgcgaccacacttccaaagggttcaagagatgg
gaatgtaaccggcctcactctccaaatggaccgctgaagttctctgaaaaattccagctc
ttcactcccttttctctaggatttgaattcaggccaggccgagaatatttctacatctcc
tctgcaatcccagataatggaagaaggtcctgtctaaagctcaaagtctttgtgagacca
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggcgagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

DBGET integrated database retrieval system