KEGG   Homo sapiens (human): 1951Help
Entry
1951              CDS       T01001                                 

Gene name
CELSR3, ADGRC3, CDHF11, EGFL1, FMI1, HFMI1, MEGF2, RESDA1
Definition
(RefSeq) cadherin EGF LAG seven-pass G-type receptor 3
  KO
K04602  
cadherin EGF LAG seven-pass G-type receptor 3
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Cell adhesion
   Cadherin EGF LAG (CELSR)
    1951 (CELSR3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Flamingos
   CELSR3; cadherin EGF LAG seven-pass G-type receptor 3 [KO:K04602]
    1951 (CELSR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 3312 aa AA seqDB search
MMARRPPWRGLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGPRAHIGGGA
LALCPESSGVREDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGS
RERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
GPKPVSSQRNAGTGSRKRVGTARCCGELWATGSKGQGERATTSGAERTAPRRNCLPGASG
SGPELDSAPRTARTAPASGSAPRESRTAPEPAPKRMRSRGLFRCRFLPQRPGPRPPGLPA
RPEARKVTSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRL
VYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVA
VTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARA
AAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDEND
NAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTG
EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSV
LENAPLGHSVIHIQAVDADHGENARLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVE
HYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTA
VDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHD
HCYVHINITDANTHRPVFQSAHYSVSVNEDRPMGSTIVVISASDDDVGENARITYLLEDN
LPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQ
FVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVR
TVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVMVQDVNDNAPVFPAEEFEVRVKENS
IVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVI
VVQATSAPLVSRATVHVRLVDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDP
DVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCV
LRVVIITEELLANSLTVRLENMWQERFLSPLLGRFLEGVAAVLATPAEDVFIFNIQNDTD
VGGTVLNVSFSALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCL
REPCENYMKCVSVLRFDSSAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCY
SNPCRNGGACARREGGYTCVCRPRFTGEDCELDTEAGRCVPGVCRNGGTCTDAPNGGFRC
QCPAGGAFEGPRCEVAARSFPPSSFVMFRGLRQRFHLTLSLSFATVQQSGLLFYNGRLNE
KHDFLALELVAGQVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLRYYNKPRTDALGGAQ
GPSKDKVAVLSVDDCDVAVALQFGAEIGNYSCAAAGVQTSSKKSLDLTGPLLLGGVPNLP
ENFPVSHKDFIGCMRDLHIDGRRVDMAAFVANNGTMAGCQAKLHFCDSGPCKNSGFCSER
WGSFSCDCPVGFGGKDCQLTMAHPHHFRGNGTLSWNFGSDMAVSVPWYLGLAFRTRATQG
VLMQVQAGPHSTLLCQLDRGLLSVTVTRGSGRASHLLLDQVTVSDGRWHDLRLELQEEPG
GRRGHHVLMVSLDFSLFQDTMAVGSELQGLKVKQLHVGGLPPGSAEEAPQGLVGCIQGVW
LGSTPSGSPALLPPSHRVNAEPGCVVTNACASGPCPPHADCRDLWQTFSCTCQPGYYGPG
CVDACLLNPCQNQGSCRHLPGAPHGYTCDCVGGYFGHHCEHRMDQQCPRGWWGSPTCGPC
NCDVHKGFDPNCNKTNGQCHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRP
GALGRQCNSCDSPFAEVTASGCRVLYDACPKSLRSGVWWPQTKFGVLATVPCPRGALGAA
VRLCDEAQGWLEPDLFNCTSPAFRELSLLLDGLELNKTALDTMEAKKLAQRLREVTGHTD
HYFSQDVRVTARLLAHLLAFESHQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAAL
GQRAPGGSPGSAGLVRHLEEYAATLARNMELTYLNPMGLVTPNIMLSIDRMEHPSSPRGA
RRYPRYHSNLFRGQDAWDPHTHVLLPSQSPRPSPSEVLPTSSSIENSTTSSVVPPPAPPE
PEPGISIIILLVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFLRGILE
SPISLEFRLLQTANRSKAICVQWDPPGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTF
GVLMDASPRERLEGDLELLAVFTHVVVAVSVAALVLTAAILLSLRSLKSNVRGIHANVAA
ALGVAELLFLLGIHRTHNQLVCTAVAILLHYFFLSTFAWLFVQGLHLYRMQVEPRNVDRG
AMRFYHALGWGVPAVLLGLAVGLDPEGYGNPDFCWISVHEPLIWSFAGPVVLVIVMNGTM
FLLAARTSCSTGQREAKKTSALTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLC
GLQGLAVLLLFCVLNADARAAWMPACLGRKAAPEEARPAPGLGPGAYNNTALFEESGLIR
ITLGASTVSSVSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAGPTDLD
VAMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLCRAAQSERLLTHP
KDVDGNDLLSYWPALGECEAAPCALQTWGSERRLGLDTSKDAANNNQPDPALTSGDETSL
GRAQRQRKGILKNRLQYPLVPQTRGAPELSWCRAATLGHRAVPAASYGRIYAGGGTGSLS
QPASRYSSREQLDLLLRRQLSRERLEEAPAPVLRPLSRPGSQECMDAAPGRLEPKDRGST
LPRRQPPRDYPGAMAGRFGSRDALDLGAPREWLSTLPPPRRTRDLDPQPPPLPLSPQRQL
SRDPLLPSRPLDSLSRSSNSREQLDQVPSRHPSREALGPLPQLLRAREDSVSGPSHGPST
EQLDILSSILASFNSSALSSVQSSSTPLGPHTTATPSATASVLGPSTPRSATSHSISELS
PDSEVPRSEGHS
NT seq 9939 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgaggcggccgccgtggcggggcctcgggggacggtcgacccccatactcctg
ctccttctcctctctttgttccccctcagccaggaggagctggggggcggtgggcaccag
ggctgggacccaggcttagctgccactacggggccaagggcgcatatcggtggcggagcc
ttagctctttgtccggagtcttccggggtccgggaggatggggggcctggcctgggggtc
agggagcctatcttcgtggggctccgagggagaaggcaaagcgcccggaatagtcgaggg
ccccctgagcagccgaatgaggagctggggattgaacacggcgtccagccattgggcagc
cgcgaacgagagacaggacagggaccagggtctgtgttatactggcgcccagaggtctcc
tcttgcgggcggacaggacctttgcaaagaggtagtctgtcaccaggggctctgtcctca
ggggtcccgggctcggggaacagctcgcccctcccttcagactttttgattcggcaccac
ggtcccaagccggtgtcctcccagcggaacgctgggacaggctcccgcaaaagagtgggc
accgcgcgctgctgtggggaattatgggcaacagggagcaagggtcagggcgagagagcc
acgacatccggagcagaaaggacagccccccggcggaactgtcttccaggggcctcggga
tctggccccgagctggattcagcaccacgcacggcgaggacagctcctgcatcaggttca
gcaccccgcgagtctcggacagctcccgagccggcgcccaagcgcatgcgctcccggggt
ctcttccgctgccgcttcctcccgcagcgccccgggccgcgtcccccgggactcccggcc
cgtcctgaagccaggaaagtaacctcggcgaaccgggcacgctttcgtcgcgccgcaaac
cgccacccgcagtttccgcagtacaactaccagacgctggtgccggagaatgaggcagca
ggcaccgcggtgctacgcgtggttgctcaggacccggacgccggcgaggccgggcgccta
gtctactcgctggcggcactcatgaacagccgctcgctggagctgttcagcatcgacccg
cagagcggccttatccgtacggcggcagctctggaccgcgagagcatggagcgtcactac
ctgcgtgtgaccgcgcaggaccacgggtcgccgcgcctctcggccaccacgatggtggcc
gtgacagtagccgaccgcaacgaccactcgccggtttttgagcaagcgcagtaccgggag
acccttcgcgagaatgtggaggagggctaccctatcctgcagctgcgtgccactgacggc
gacgcgccccccaacgccaacctgcgctaccgcttcgtggggccgccagctgcgcgcgct
gcagctgccgccgccttcgagattgatccacgctccggcctcatcagcaccagcggccga
gtggaccgcgagcacatggaaagctatgagctggtggtggaagccagcgaccagggccag
gaacccgggccgcgctcggccactgtgcgcgtacacataactgtgctagacgagaacgac
aatgctcctcagttcagcgagaagcgctacgtggcgcaggtgcgcgaggatgtgcgcccc
cacacagtcgtgctgcgcgtcacggccactgaccgggacaaggacgccaacggattggtg
cactacaacatcatcagtggcaatagccgtggacactttgccatcgacagcctcactggc
gagatccaggtggtggcacctctggacttcgaggcagagagagagtatgccttgcgcatc
agggcgcaggatgctggccggccaccgctgtccaacaacacgggcctggccagcatccag
gtggtggacatcaatgaccacattcctatttttgtcagcacgcccttccaagtttctgtc
ttggaaaatgctcccttgggtcactcagtcatccacattcaggcagtcgatgcagaccat
ggggagaatgccagattggagtactccctaactggtgtggcacctgatactccttttgtg
ataaacagcgccactggctgggtctctgtgagtggtcccctggaccgtgagtctgtggag
cattacttctttggtgtggaggctcgagaccatggctcacccccactctctgcctcagcc
agtgtcaccgtgactgtgctggacgttaatgacaatcggcctgagttcacaatgaaggag
taccacctacgactgaatgaggatgcagctgtgggcaccagtgtggtcagcgtgaccgca
gtagaccgtgatgccaacagtgccatcagctaccagatcacaggcggcaacacccggaat
cgctttgccatcagcacccaggggggtgtgggtctggtgactctggctctgccactggac
tacaagcaggaacgctacttcaagctggtactaactgcatctgaccgtgcccttcatgat
cactgctatgtgcacatcaacatcacagatgccaacactcatcggccggtctttcaaagt
gcccactactcagtgagtgtgaatgaagatcggccaatgggtagcaccatagtggtcatc
agtgcctctgatgatgacgtgggtgagaatgctcgtatcacctatctcctggaggacaac
ctgccccagttccgcattgatgcagactcaggagccattacattacaggccccattagac
tatgaggaccaggtgacctacaccctggctatcacagctcgggacaatggcatcccacag
aaggcagacactacttatgtggaggtgatggtcaatgacgtgaatgacaatgctccacaa
tttgtggcctcccactatacagggctggtctctgaggatgccccacctttcaccagtgtc
ctgcagatctcagccactgaccgggatgctcatgccaatggccgggtccagtacactttc
cagaatggtgaagatggggatggagattttaccattgagcccacctctggaattgtccgt
acagtaaggcggctagaccgggaggcagtatcagtgtatgagttgactgcctacgcagtg
gacagaggtgtgcccccactccggactccagtcagtatccaggtgatggtgcaggatgtg
aacgacaatgcacctgtcttcccagctgaggagtttgaggtgcgggtgaaagagaatagc
attgtgggctcagtggtggcccagatcactgcagtggaccctgacgaaggccccaatgcc
catataatgtaccagatcgtggaggggaacatccctgagctgttccaaatggacatcttc
tctggagaactgacggcactcattgacctagactatgaggctcgccaagaatatgtgatt
gtggtgcaggccacatctgctcctttggtcagccgggccactgtgcacgtccgcctggtt
gaccagaatgacaacagccctgtgctcaacaacttccagatcctcttcaacaactatgta
tccaaccgttcagacaccttcccgtcgggcattattgggcgcatcccagcttatgacccc
gatgtctccgaccacctcttctactcctttgagcgtggcaatgagctgcagctgctggta
gtcaaccagaccagtggggagctgcgactcagccgaaagctagacaataaccgcccactg
gtggcctccatgttggtgactgtcacagatggcctgcacagcgtgacggcgcagtgtgtg
ctgcgcgtggtcatcatcacggaggagttgctggccaacagcctgaccgtgcgccttgag
aacatgtggcaggagcgcttcctgtcaccgctgctgggccgcttcctcgagggcgtggct
gcggtgctcgctacgcccgctgaggacgtcttcatcttcaacatccagaacgacacagac
gtagggggcaccgtgctcaatgtgagtttctcggcgctagctccacgtggggccggggcg
ggcgctgcagggccctggttcagctccgaggagctgcaggagcagttgtacgtgcgccgg
gcggcgctggcggctcgctccctgctcgacgtactgcccttcgacgacaacgtgtgcctg
cgagagccctgtgagaactacatgaaatgcgtgtccgtgctccgctttgactcgtccgcg
cccttcctggcctcggcctccacgctgttccgacccatccagcccatcgctggcctgcgc
tgccgctgcccgcccggattcacgggagacttttgcgagaccgagctcgacctctgctac
tccaacccatgtcgcaacggcggagcctgcgcgcggcgcgagggaggctacacgtgcgtc
tgccgcccgcgcttcaccggagaggactgcgagctggacaccgaggccggccgctgcgtg
ccgggcgtctgccgcaacgggggcacctgcaccgacgcgcccaacggcggctttcgctgc
cagtgcccggcaggcggcgccttcgagggcccgcgctgcgaggtggctgcgcgctccttc
ccgcccagttcgttcgtcatgtttcgcggcctgcggcagcgattccaccttacgctgtcc
ctctcgttcgcgacagtgcagcagagcgggctgctcttctacaacgggcgcctgaacgag
aagcacgacttcctggccctggaactcgtggctggccaagtgcggctcacatattccacg
ggtgaatccaacaccgtggtcagccccacagttccagggggcttgagtgacgggcaatgg
catacagtgcatctgagatactacaacaagccccggacagatgccctagggggtgcacag
ggcccctccaaggacaaggtggctgtgctaagcgtggatgattgtgatgtggccgtggct
ctgcagtttggtgctgagattggcaactactcatgcgcggctgctggtgtgcaaacaagc
tccaagaagtccctggacctgacgggccctcttcttctgggaggtgtccccaacctcccc
gagaacttccccgtatcccataaggacttcatcggctgtatgcgggacctgcacattgat
ggccgccgagtggacatggcggcttttgtcgcaaataatggcaccatggcaggctgccaa
gccaagctacacttttgtgactcaggcccctgcaagaacagtggcttctgctcggagcgc
tggggcagcttcagctgcgactgccctgtgggcttcggcggcaaagactgtcagcttact
atggcccatccccaccatttccgtggcaacggcacactgagctggaactttggaagtgac
atggctgtgtctgtgccatggtacctggggctggcatttcggacacgggcaacgcagggg
gtcctgatgcaagtgcaggctgggccacacagcacgctcctttgccagctagatcggggg
ttactgtctgtgacagtgaccaggggctcgggccgtgcttcccatctccttctggaccag
gtgactgtcagtgatggccggtggcacgatctgcggctggagttgcaggaggaaccaggt
ggccggcggggccaccatgtccttatggtctcactggactttagcctcttccaggacacc
atggcggtggggagtgagctgcagggcctgaaggtaaagcagctccacgtgggaggcctg
ccccccggcagtgcagaggaggctcctcagggtctggttggctgcatccagggggtgtgg
ctcggctccacaccctctggctccccggccctgctaccccccagccaccgagtgaatgcg
gagcctggctgtgttgtgaccaacgcctgtgcctctgggccctgcccacctcacgcagac
tgccgggacctctggcagaccttttcttgcacctgccagccaggttactacggcccaggc
tgtgtggatgcctgcctcctgaacccctgtcagaaccagggatcatgccggcacctgcca
ggagccccccatggctatacctgtgactgtgtgggtggctatttcgggcaccactgtgag
cacaggatggaccagcagtgcccacggggctggtgggggagcccaacctgtggcccctgc
aactgtgatgttcacaaaggttttgatcccaactgcaacaagacaaatgggcagtgtcac
tgcaaggagttccactaccgaccgcggggcagtgactcttgcctcccatgtgactgctac
cctgtgggctccacctcgcgctcatgtgcaccccacagcgggcagtgcccctgtcgccca
ggagcccttggccgccagtgcaacagctgtgacagtcccttcgcagaggtgacagccagc
ggctgccgggtgctctatgatgcctgccctaagtccctgagatctggtgtgtggtggccc
cagacaaagtttggcgtcctggccacagtgccctgtccccggggggccctgggtgctgct
gtgcggctgtgtgatgaggcccagggttggctggagcccgacctcttcaactgtacctcc
cctgcctttcgagagctcagtctgctgctggatggcctagagctgaacaagacggcactg
gataccatggaggccaagaagctggctcagcggctacgggaggtgactggccacactgac
cactattttagccaagatgttcgagtcactgcccgcctgctggcccacctgctggccttc
gagagccatcagcagggcttcgggctgacagccacacaggatgcccacttcaatgagaat
ctgctgtgggccggctctgcactgcttgccccagagacaggggacttgtgggcggcgctg
gggcagcgggcccctgggggctccccaggcagcgcgggactggtgaggcacctggaggag
tatgcagccacactcgcaaggaatatggaactcacatacctgaatcccatggggctggtg
acgcctaatatcatgctcagcattgaccgcatggagcaccccagttctccccggggggcc
cgtcgctaccctcgctaccatagcaacctctttcgaggccaggatgcctgggatcctcac
acccatgtgctgctgccttcccagtccccacggccatccccatctgaagttctgcccaca
agcagcagcatagaaaactccaccacctcaagtgtggtccccccaccagccccgccagag
ccagagcctgggatctccattatcattctcctcgtttaccgcaccttagggggactgctc
cctgcccagttccaggcagaacgccgaggtgccaggcttcctcagaaccccgtcatgaac
tccccggtggtcagcgtggctgtgttccacggacgcaacttcctaaggggaatcctggag
tcccccatcagcctagagtttcgcctgctacagacagcgaatcggagcaaggcgatctgt
gtgcagtgggacccacctggcctggcggagcagcatggtgtgtggacagcacgggactgc
gagctggtgcacaggaatgggtcccacgcacggtgtcgctgcagccggacagggaccttt
ggggtcctcatggatgcctctccccgtgagaggctggagggcgacctggagctgctggct
gtgttcacccacgtggtcgtggctgtgtctgtggctgcgctggtgctgactgcagccatc
ctgctgagcctgcgcagcctcaagtccaatgtgcgtgggatccatgccaatgtggcagcc
gccctgggggtggcagagctcctcttcctgctggggattcacaggacccacaatcagctg
gtgtgcactgcagtcgccatcctcctgcactacttcttcctcagcaccttcgcgtggctc
ttcgtgcaggggctgcacctctaccgcatgcaggttgagccacgcaacgtggaccgcggc
gccatgcgcttctaccatgccctgggctggggcgtccctgctgtgctgctgggccttgct
gtgggcctggaccctgagggctatgggaaccctgacttctgctggatctcagtccacgag
cccctcatctggagctttgctggccctgttgtcctggtcatagtgatgaacgggaccatg
tttctcctcgctgcccgcacatcctgctccacagggcagagggaggccaagaagacctct
gcactgacccttcgcagctccttcctgctgcttctgctggtcagtgcctcctggctcttt
gggctcctggcagtcaaccacagcatcctagccttccactacctccatgctggactctgc
ggcctccagggcctggcggtgctgctgctcttctgtgtcctaaatgcagatgctcgggct
gcctggatgccagcctgtctgggcaggaaggcagcgcctgaggaggcaaggccagcacct
gggctgggacctggggcctacaacaacacggctctctttgaggagagtggcctcatccgc
atcactctgggcgcctccaccgtctcctctgtgagcagtgcccgctccggccggacccag
gaccaggacagccagcggggccgcagctacctcagggacaatgtcctggttcgacatggc
tcagccgctgaccacactgaccacagcctccaggctcatgctggccccactgacctggac
gtggccatgttccatcgagatgctggcgcagactccgactctgacagtgacctgtccttg
gaggaggagaggagtctctccattccatcttcagaaagcgaggacaatggccggacgcgg
gggcgcttccaacggccactctgccgagcagcccagagtgagaggctcctcacccacccc
aaagatgtggatggcaatgacctcctgtcctactggccagccctgggggagtgcgaggca
gccccctgtgctctgcagacttggggctctgaaaggcgcctggggctggacaccagcaag
gatgcagctaacaacaaccagccagacccggccctgaccagtggggatgagacttctctg
ggccgggcccagcgccagaggaaaggcatcctgaagaaccggttgcaatacccactggtg
ccacagacccgaggtgcccctgagctgtcctggtgccgtgcagccaccttgggccaccgt
gctgtgccagctgcctcttacggtcgcatctatgctggcgggggcacgggcagcctttca
cagccagccagccgctactcttctagagaacagctggacctgctcctccggcggcaactg
agccgtgagcgactagaggaagcccctgcccctgttctacgtcccctgagccggccaggg
tcccaggaatgcatggatgctgcaccaggccgactggagcccaaagatcggggcagcacc
ctgccacggaggcagccacctcgggactaccctggcgccatggctggccgcttcgggtca
cgggatgcgctcgacttaggggcacctcgagagtggttgagcacgctgcctccgccccgc
cgcacccgggaccttgacccacagcccccacctctgcccctgtctccccagcggcaactc
tcaagggaccccctcttgccatcccggccgctggactctctgtctaggagctcgaactct
cgggagcagctggaccaggtgcctagccggcacccctcacgagaagcccttgggccactc
ccgcagctgctcagagctagggaggactcggtcagtggccccagccatggcccctccaca
gaacagttggacattctttcctccatccttgcctctttcaactcctcggccctctcctct
gtgcaatcttcaagcacacccttgggccctcacaccactgccacaccttctgccacagcc
tctgtgcttgggccctccacgccacgttctgccacgtctcacagcatctcggagctgtcg
ccagactcagaagttcccagaagtgagggtcactcctga

DBGET integrated database retrieval system