KEGG   Homo sapiens (human): 1958Help
Entry
1958              CDS       T01001                                 

Gene name
EGR1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Definition
early growth response 1
Orthology
K09203  
early growth response protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Prion diseases
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    1958 (EGR1)
  Infectious diseases
   05166 HTLV-I infection
    1958 (EGR1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    1958 (EGR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 543 aa AA seqDB search
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccaaggccgagatgcagctgatgtccccgctgcagatctctgacccgttc
ggatcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggcgccgccggggccccagagggcagcggcagc
aacagcagcagcagcagcagcgggggcggtggaggcggcgggggcggcagcaacagcagc
agcagcagcagcaccttcaaccctcaggcggacacgggcgagcagccctacgagcacctg
accgcagagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagaccagt
taccccagccaaaccactcgactgccccccatcacctatactggccgcttttccctggag
cctgcacccaacagtggcaacaccttgtggcccgagcccctcttcagcttggtcagtggc
ctagtgagcatgaccaacccaccggcctcctcgtcctcagcaccatctccagcggcctcc
tccgcctccgcctcccagagcccacccctgagctgcgcagtgccatccaacgacagcagt
cccatttactcagcggcacccaccttccccacgccgaacactgacattttccctgagcca
caaagccaggccttcccgggctcggcagggacagcgctccagtacccgcctcctgcctac
cctgccgccaagggtggcttccaggttcccatgatccccgactacctgtttccacagcag
cagggggatctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgc
acccagcagccttcgctaacccctctgtctactattaaggcctttgccactcagtcgggc
tcccaggacctgaaggccctcaataccagctaccagtcccagctcatcaaacccagccgc
atgcgcaagtaccccaaccggcccagcaagacgcccccccacgaacgcccttacgcttgc
ccagtggagtcctgtgatcgccgcttctcccgctccgacgagctcacccgccacatccgc
atccacacaggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagc
gaccacctcaccacccacatccgcacccacacaggcgaaaagcccttcgcctgcgacatc
tgtggaagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcgg
cagaaggacaagaaagcagacaaaagtgttgtggcctcttcggccacctcctctctctct
tcctacccgtccccggttgctacctcttacccgtccccggttactacctcttatccatcc
ccggccaccacctcatacccatcccctgtgcccacctccttctcctctcccggctcctcg
acctacccatcccctgtgcacagtggcttcccctccccgtcggtggccaccacgtactcc
tctgttccccctgctttcccggcccaggtcagcagcttcccttcctcagctgtcaccaac
tccttcagcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaatt
gaaatttgctaa

DBGET integrated database retrieval system