KEGG   Homo sapiens (human): 1958Help
Entry
1958              CDS       T01001                                 

Gene name
EGR1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Definition
early growth response 1
Orthology
K09203  
early growth response protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Prion diseases
HTLV-I infection
Class
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 543 aa AA seqDB search
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccaaggccgagatgcagctgatgtccccgctgcagatctctgacccgttc
ggatcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggcgccgccggggccccagagggcagcggcagc
aacagcagcagcagcagcagcgggggcggtggaggcggcgggggcggcagcaacagcagc
agcagcagcagcaccttcaaccctcaggcggacacgggcgagcagccctacgagcacctg
accgcagagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagaccagt
taccccagccaaaccactcgactgccccccatcacctatactggccgcttttccctggag
cctgcacccaacagtggcaacaccttgtggcccgagcccctcttcagcttggtcagtggc
ctagtgagcatgaccaacccaccggcctcctcgtcctcagcaccatctccagcggcctcc
tccgcctccgcctcccagagcccacccctgagctgcgcagtgccatccaacgacagcagt
cccatttactcagcggcacccaccttccccacgccgaacactgacattttccctgagcca
caaagccaggccttcccgggctcggcagggacagcgctccagtacccgcctcctgcctac
cctgccgccaagggtggcttccaggttcccatgatccccgactacctgtttccacagcag
cagggggatctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgc
acccagcagccttcgctaacccctctgtctactattaaggcctttgccactcagtcgggc
tcccaggacctgaaggccctcaataccagctaccagtcccagctcatcaaacccagccgc
atgcgcaagtaccccaaccggcccagcaagacgcccccccacgaacgcccttacgcttgc
ccagtggagtcctgtgatcgccgcttctcccgctccgacgagctcacccgccacatccgc
atccacacaggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagc
gaccacctcaccacccacatccgcacccacacaggcgaaaagcccttcgcctgcgacatc
tgtggaagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcgg
cagaaggacaagaaagcagacaaaagtgttgtggcctcttcggccacctcctctctctct
tcctacccgtccccggttgctacctcttacccgtccccggttactacctcttatccatcc
ccggccaccacctcatacccatcccctgtgcccacctccttctcctctcccggctcctcg
acctacccatcccctgtgcacagtggcttcccctccccgtcggtggccaccacgtactcc
tctgttccccctgctttcccggcccaggtcagcagcttcccttcctcagctgtcaccaac
tccttcagcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaatt
gaaatttgctaa

DBGET integrated database retrieval system