KEGG   Homo sapiens (human): 1959Help
Entry
1959              CDS       T01001                                 

Gene name
EGR2, AT591, CMT1D, CMT4E, KROX20
Definition
early growth response 2
Orthology
K12496  
early growth response protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1959 (EGR2)
  Infectious diseases
   05166 HTLV-I infection
    1959 (EGR2)
   05161 Hepatitis B
    1959 (EGR2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    1959 (EGR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q21.1
AA seq 476 aa AA seqDB search
MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMI
NIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI
LQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGD
LYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHG
TAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSA
AAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRH
IRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH
LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgccaaggccgtagacaaaatcccagtaactctcagtggttttgtgcaccag
ctgtctgacaacatctacccggtggaggacctcgccgccacgtcggtgaccatctttccc
aatgccgaactgggaggcccctttgaccagatgaacggagtggccggagatggcatgatc
aacattgacatgactggagagaagaggtcgttggatctcccatatcccagcagctttgct
cccgtctctgcacctagaaaccagaccttcacttacatgggcaagttctccattgaccct
cagtaccctggtgccagctgctacccagaaggcataatcaatattgtgagtgcaggcatc
ttgcaaggggtcacttccccagcttcaaccacagcctcatccagcgtcacctctgcctcc
cccaacccactggccacaggacccctgggtgtgtgcaccatgtcccagacccagcctgac
ctggaccacctgtactctccgccaccgcctcctcctccttattctggctgtgcaggagac
ctctaccaggacccttctgcgttcctgtcagcagccaccacctccacctcttcctctctg
gcctacccaccacctccttcctatccatcccccaagccagccacggacccaggtctcttc
ccaatgatcccagactatcctggattctttccatctcagtgccagagagacctacatggt
acagctggcccagaccgtaagccctttccctgcccactggacaccctgcgggtgccccct
ccactcactccactctctacaatccgtaactttaccctggggggccccagtgctggggtg
accggaccaggggccagtggaggcagcgagggaccccggctgcctggtagcagctcagca
gcagcagcagccgccgccgccgccgcctataacccacaccacctgccactgcggcccatt
ctgaggcctcgcaagtaccccaacagacccagcaagacgccggtgcacgagaggccctac
ccgtgcccagcagaaggctgcgaccggcggttctcccgctctgacgagctgacacggcac
atccgaatccacactgggcataagcccttccagtgtcggatctgcatgcgcaacttcagc
cgcagtgaccacctcaccacccatatccgcacccacaccggtgagaagcccttcgcctgt
gactactgtggccgaaagtttgcccggagtgatgagaggaagcgccacaccaagatccac
ctgagacagaaagagcggaaaagcagtgccccctctgcatcggtgccagccccctctaca
gcctcctgctctgggggcgtgcagcctgggggtaccctgtgcagcagtaacagcagcagt
cttggcggagggccgctcgccccttgctcctctcggacccggacaccttga

DBGET integrated database retrieval system