KEGG   Homo sapiens (human): 1960Help
Entry
1960              CDS       T01001                                 

Gene name
EGR3, EGR-3, PILOT
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1960 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    1960 (EGR3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    1960 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p23-p21
AA seq 349 aa AA seqDB search
MEPCAAWSPRGGRENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWC
QDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPV
SFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPI
RVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACP
AEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFC
GRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagccatgtgcggcgtggagtccccgcggtgggagagagaatgtaatggacatcggt
ctgaccaacgagaagcccaacccggaactctcttactccggctccttccagccagccccc
ggcaacaagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgc
caggacaacatcattagcctcatgagcgccggcatcttgggggtgcccccggcttcaggg
gcgctcagcacgcagacgtccacggccagcatggtgcagccaccgcagggtgacgtggag
gccatgtatcccgcgctacccccctactccaactgcggcgacctctactcagagcccgtg
tctttccacgacccccagggcaatcccgggctcgcctattccccccaggattaccaatcg
gccaagccggcgttggacagcaatctcttccccatgattcctgactacaacctctaccac
caccccaacgacatgggctccattccggagcacaagcccttccagggcatggaccccatc
cgggtcaacccgccccctattacccctctggagaccatcaaggcattcaaagacaagcag
atccacccgggctttggcagcctgccccagccgccgctcaccctcaagcccatccggccc
cgcaagtaccccaaccggcctagcaagacaccgctccacgaacggccccacgcgtgcccg
gccgagggctgcgaccgccgtttcagccgttcggacgagctgacccggcacctgcgcatc
cacacgggccacaagcccttccagtgccggatctgcatgcggagcttcagccgcagcgac
cacctcaccactcacatccgcactcatacgggcgagaagccctttgcctgcgagttctgc
gggcgcaagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaa
aaggagaagaaggcggagaagggcggtgcaccctctgcatcctcggcgccccccgtgtcg
ctggcccccgtggtcaccacctgcgcctga

DBGET integrated database retrieval system