KEGG   Homo sapiens (human): 196335Help
Entry
196335            CDS       T01001                                 

Gene name
OR56B4, OR11-67
Definition
(RefSeq) olfactory receptor family 56 subfamily B member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    196335 (OR56B4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    196335 (OR56B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 196335
NCBI-ProteinID: NP_001005181
HGNC: 15248
Ensembl: ENSG00000180919
Vega: OTTHUMG00000165531
Pharos: Q8NH76(Tdark)
UniProt: Q8NH76
Position
11p15.4
AA seq 319 aa AA seqDB search
MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETV
LHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGI
FLCMAVDRYIAICRPLQYPSIVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEI
EHCLCSNLGVISLACDDITVNKFYQLMLAWVLVGSDMALVFSSYAVILHSVLRLNSAEAM
SKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFLNVLHNVIPPALNPLACALRM
HKLRLGFQRLLGLGQDVSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggatacctccaccagtgttacctatgactccagcctccagatttcccagttcatcctg
atgggattaccaggcattcatgagtggcagcactggctctccctgcccctgactctgctc
tacctcttagctcttggtgccaatctcctcatcataatcaccattcaacatgagaccgtg
ctacatgaacccatgtaccatttgctgggcatattagcagtggtggacattggcctggcc
accaccatcatgcccaagatcctggccatcttctggtttgatgccaaggccattagcctc
cccatgtgttttgctcagatctatgccatccactgcttcttctgcatagagtcaggcatc
tttctctgcatggcagtagacagatacatagccatctgtcgccctcttcagtacccctcc
atagtcactaaagcttttgtcttcaaagccacagggttcatcatgctcaggaatggcctg
ttgaccatcccagtgcctatactggctgcccagagacactactgttccaggaatgaaatc
gagcactgcctctgctctaacttgggggttatcagcctggcttgtgatgacatcactgtg
aacaaattttaccaactgatgctagcatgggtcttggttgggagtgatatggctctggta
ttttcttcctatgctgtaatccttcactctgtgctgaggctgaactcagcagaagcaatg
tccaaggctctgagcacttgtagctcccacctcatcctcatcctcttccacacaggtatc
attgtgctgtctgtcacacaccttgcagagaaaaagattccccttattcctgtgttcctt
aatgtgctgcacaatgtcatcccccctgcactcaaccccctggcctgtgcactcaggatg
cacaaactcagactgggctttcagagactgcttggactgggtcaggacgtgtccaagtaa

DBGET integrated database retrieval system