KEGG   Homo sapiens (human): 1964Help
Entry
1964              CDS       T01001                                 

Gene name
EIF1AX, EIF1A, EIF1AP1, EIF4C, eIF-1A, eIF-4C
Definition
(RefSeq) eukaryotic translation initiation factor 1A, X-linked
  KO
K03236  
translation initiation factor 1A
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1964 (EIF1AX)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    1964 (EIF1AX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P47813(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.12
AA seq 144 aa AA seqDB search
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH
IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
FGPGDDDEIQFDDIGDDDEDIDDI
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaataaaggtaaaggaggtaaaaacagacgcaggggtaagaatgagaatgaa
tctgaaaaaagagaactggtattcaaagaggatggtcaggagtatgctcaggtaatcaaa
atgttgggaaatggacggctagaagcaatgtgtttcgatggtgtaaagaggttatgtcac
atcagaggaaaattgagaaaaaaggtttggataaatacctcggacattattttggttggt
ctccgagactaccaggataacaaagctgatgtaattttaaaatacaatgcagacgaagct
agaagtctgaaggcatacggcgagcttccagagcatgctaaaatcaatgaaactgataca
tttggtcctggagatgatgatgaaattcagtttgatgacattggagatgatgatgaagat
attgatgacatctaa

DBGET integrated database retrieval system