KEGG   Homo sapiens (human): 196403Help
Entry
196403            CDS       T01001                                 

Gene name
DTX3, RNF154, deltex3
Definition
deltex 3, E3 ubiquitin ligase
Orthology
K06058  
deltex
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    196403 (DTX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.3
AA seq 350 aa AA seqDB search
MPILSSSGSKMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDI
YVLQLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEM
HRAGPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTL
EKCRHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGT
IVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTS
MTTGRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccaattctaagctcttcaggatcaaaaatggcagcctgtggaggcacctgcaagaac
aaagtgactgtgtccaagcccgtgtgggacttcctgagcaaagagaccccagcccggctg
gcccggcttcgggaggagcaccgtgtgtccatcctcatagatggcgagacttctgacatc
tatgttctccagctttccccacagggtcctcccccggcccctccaaatgggctctaccta
gcccggaaggctctcaaggggctgctaaaagaggcagagaaagagctgaagaaagctcag
aggcagggggagctgatgggctgcctggctctggggggtggaggggagcaccctgagatg
caccgcgcaggcccaccccctctccgagcagccccacttctgcccccaggagctcggggg
ctcccccctcctcctccccccctgcccccacctcttcctcctcgccttcgggaggaggca
gaagagcaggagagcacctgccccatctgtctgggggagatccagaatgccaagacattg
gagaagtgccggcattcattctgcgagggctgcatcacccgggctctgcaggtgaaaaag
gcctgccccatgtgcggccgcttctatgggcagctggtgggcaaccagccccagaatggg
cggatgctggtctctaaggacgccaccctcctactgcccagctatgagaagtacggcacc
attgtcatccagtacgtcttcccgcccggtgtccagggggctgaacacccaaacccagga
gttcggtatcctggcaccacacgggtggcctacctcccggactgccctgagggcaacaag
gtgctgaccctgttccgcaaggcgtttgaccagcgtctcaccttcactatcggcacgtcc
atgaccacagggagaccgaatgtcatcacctggaacgacatccaccacaagaccagctgc
acagggggaccccagctgtttgggtacccagaccccacctacctgacccgggtgcaagag
gagctgagagcgaagggtatcacagatgactga

DBGET integrated database retrieval system