KEGG   Homo sapiens (human): 196403Help
Entry
196403            CDS       T01001                                 

Gene name
DTX3, RNF154, deltex3
Definition
(RefSeq) deltex 3, E3 ubiquitin ligase
  KO
K06058  
deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    196403 (DTX3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     196403 (DTX3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    196403 (DTX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.3
AA seq 350 aa AA seqDB search
MPILSSSGSKMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDI
YVLQLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEM
HRAGPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTL
EKCRHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGT
IVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTS
MTTGRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccaattctaagctcttcaggatcaaaaatggcagcctgtggaggcacctgcaagaac
aaagtgactgtgtccaagcccgtgtgggacttcctgagcaaagagaccccagcccggctg
gcccggcttcgggaggagcaccgtgtgtccatcctcatagatggcgagacttctgacatc
tatgttctccagctttccccacagggtcctcccccggcccctccaaatgggctctaccta
gcccggaaggctctcaaggggctgctaaaagaggcagagaaagagctgaagaaagctcag
aggcagggggagctgatgggctgcctggctctggggggtggaggggagcaccctgagatg
caccgcgcaggcccaccccctctccgagcagccccacttctgcccccaggagctcggggg
ctcccccctcctcctccccccctgcccccacctcttcctcctcgccttcgggaggaggca
gaagagcaggagagcacctgccccatctgtctgggggagatccagaatgccaagacattg
gagaagtgccggcattcattctgcgagggctgcatcacccgggctctgcaggtgaaaaag
gcctgccccatgtgcggccgcttctatgggcagctggtgggcaaccagccccagaatggg
cggatgctggtctctaaggacgccaccctcctactgcccagctatgagaagtacggcacc
attgtcatccagtacgtcttcccgcccggtgtccagggggctgaacacccaaacccagga
gttcggtatcctggcaccacacgggtggcctacctcccggactgccctgagggcaacaag
gtgctgaccctgttccgcaaggcgtttgaccagcgtctcaccttcactatcggcacgtcc
atgaccacagggagaccgaatgtcatcacctggaacgacatccaccacaagaccagctgc
acagggggaccccagctgtttgggtacccagaccccacctacctgacccgggtgcaagag
gagctgagagcgaagggtatcacagatgactga

DBGET integrated database retrieval system