KEGG   Homo sapiens (human): 196403Help
Entry
196403            CDS       T01001                                 

Gene name
DTX3, RNF154, deltex3
Definition
(RefSeq) deltex E3 ubiquitin ligase 3
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    196403 (DTX3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     196403 (DTX3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    196403 (DTX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf-RING_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-rbx1 zf-RING_5 Prok-RING_4 zf-Nse zf-C3HC4_4 zf-RING_10 zf-ANAPC11 zf-RING_11 DUF1644
Motif
Other DBs
NCBI-GeneID: 196403
NCBI-ProteinID: NP_001273175
OMIM: 613142
HGNC: 24457
Ensembl: ENSG00000178498
Vega: OTTHUMG00000170189
Pharos: Q8N9I9(Tbio)
UniProt: Q8N9I9 A0A024RB96
Position
12q13.3
AA seq 347 aa AA seqDB search
MSFVLSRMAACGGTCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVL
QLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPEMHRA
GPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREEAEEQESTCPICLGEIQNAKTLEKC
RHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVI
QYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT
GRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgtcctgtccagaatggcagcctgtggaggcacctgcaagaacaaagtgact
gtgtccaagcccgtgtgggacttcctgagcaaagagaccccagcccggctggcccggctt
cgggaggagcaccgtgtgtccatcctcatagatggcgagacttctgacatctatgttctc
cagctttccccacagggtcctcccccggcccctccaaatgggctctacctagcccggaag
gctctcaaggggctgctaaaagaggcagagaaagagctgaagaaagctcagaggcagggg
gagctgatgggctgcctggctctggggggtggaggggagcaccctgagatgcaccgcgca
ggcccaccccctctccgagcagccccacttctgcccccaggagctcgggggctcccccct
cctcctccccccctgcccccacctcttcctcctcgccttcgggaggaggcagaagagcag
gagagcacctgccccatctgtctgggggagatccagaatgccaagacattggagaagtgc
cggcattcattctgcgagggctgcatcacccgggctctgcaggtgaaaaaggcctgcccc
atgtgcggccgcttctatgggcagctggtgggcaaccagccccagaatgggcggatgctg
gtctctaaggacgccaccctcctactgcccagctatgagaagtacggcaccattgtcatc
cagtacgtcttcccgcccggtgtccagggggctgaacacccaaacccaggagttcggtat
cctggcaccacacgggtggcctacctcccggactgccctgagggcaacaaggtgctgacc
ctgttccgcaaggcgtttgaccagcgtctcaccttcactatcggcacgtccatgaccaca
gggagaccgaatgtcatcacctggaacgacatccaccacaagaccagctgcacaggggga
ccccagctgtttgggtacccagaccccacctacctgacccgggtgcaagaggagctgaga
gcgaagggtatcacagatgactga

DBGET integrated database retrieval system