KEGG   Homo sapiens (human): 1969Help
Entry
1969              CDS       T01001                                 

Gene name
EPHA2, ARCC2, CTPA, CTPP1, CTRCT6, ECK
Definition
(RefSeq) EPH receptor A2
  KO
K05103  
Eph receptor A2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
Disease
H01202  
Cataract
Drug target
Dasatinib (DG00714): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1969 (EPHA2)
   04015 Rap1 signaling pathway
    1969 (EPHA2)
   04151 PI3K-Akt signaling pathway
    1969 (EPHA2)
 Organismal Systems
  Development
   04360 Axon guidance
    1969 (EPHA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1969 (EPHA2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Eph family
   1969 (EPHA2)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class VIII (EPH receptor family)
   1969 (EPHA2)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   1969 (EPHA2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  EFNA; ephrin-A [KO:K05462]
   1969 (EPHA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36
AA seq 976 aa AA seqDB search
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggagctccaggcagcccgcgcctgcttcgccctgctgtggggctgtgcgctggccgcg
gccgcggcggcgcagggcaaggaagtggtactgctggactttgctgcagctggaggggag
ctcggctggctcacacacccgtatggcaaagggtgggacctgatgcagaacatcatgaat
gacatgccgatctacatgtactccgtgtgcaacgtgatgtctggcgaccaggacaactgg
ctccgcaccaactgggtgtaccgaggagaggctgagcgtatcttcattgagctcaagttt
actgtacgtgactgcaacagcttccctggtggcgccagctcctgcaaggagactttcaac
ctctactatgccgagtcggacctggactacggcaccaacttccagaagcgcctgttcacc
aagattgacaccattgcgcccgatgagatcaccgtcagcagcgacttcgaggcacgccac
gtgaagctgaacgtggaggagcgctccgtggggccgctcacccgcaaaggcttctacctg
gccttccaggatatcggtgcctgtgtggcgctgctctccgtccgtgtctactacaagaag
tgccccgagctgctgcagggcctggcccacttccctgagaccatcgccggctctgatgca
ccttccctggccactgtggccggcacctgtgtggaccatgccgtggtgccaccggggggt
gaagagccccgtatgcactgtgcagtggatggcgagtggctggtgcccattgggcagtgc
ctgtgccaggcaggctacgagaaggtggaggatgcctgccaggcctgctcgcctggattt
tttaagtttgaggcatctgagagcccctgcttggagtgccctgagcacacgctgccatcc
cctgagggtgccacctcctgcgagtgtgaggaaggcttcttccgggcacctcaggaccca
gcgtcgatgccttgcacacgacccccctccgccccacactacctcacagccgtgggcatg
ggtgccaaggtggagctgcgctggacgccccctcaggacagcgggggccgcgaggacatt
gtctacagcgtcacctgcgaacagtgctggcccgagtctggggaatgcgggccgtgtgag
gccagtgtgcgctactcggagcctcctcacggactgacccgcaccagtgtgacagtgagc
gacctggagccccacatgaactacaccttcaccgtggaggcccgcaatggcgtctcaggc
ctggtaaccagccgcagcttccgtactgccagtgtcagcatcaaccagacagagcccccc
aaggtgaggctggagggccgcagcaccacctcgcttagcgtctcctggagcatccccccg
ccgcagcagagccgagtgtggaagtacgaggtcacttaccgcaagaagggagactccaac
agctacaatgtgcgccgcaccgagggtttctccgtgaccctggacgacctggccccagac
accacctacctggtccaggtgcaggcactgacgcaggagggccagggggccggcagcaag
gtgcacgaattccagacgctgtccccggagggatctggcaacttggcggtgattggcggc
gtggctgtcggtgtggtcctgcttctggtgctggcaggagttggcttctttatccaccgc
aggaggaagaaccagcgtgcccgccagtccccggaggacgtttacttctccaagtcagaa
caactgaagcccctgaagacatacgtggacccccacacatatgaggaccccaaccaggct
gtgttgaagttcactaccgagatccatccatcctgtgtcactcggcagaaggtgatcgga
gcaggagagtttggggaggtgtacaagggcatgctgaagacatcctcggggaagaaggag
gtgccggtggccatcaagacgctgaaagccggctacacagagaagcagcgagtggacttc
ctcggcgaggccggcatcatgggccagttcagccaccacaacatcatccgcctagagggc
gtcatctccaaatacaagcccatgatgatcatcactgagtacatggagaatggggccctg
gacaagttccttcgggagaaggatggcgagttcagcgtgctgcagctggtgggcatgctg
cggggcatcgcagctggcatgaagtacctggccaacatgaactatgtgcaccgtgacctg
gctgcccgcaacatcctcgtcaacagcaacctggtctgcaaggtgtctgactttggcctg
tcccgcgtgctggaggacgaccccgaggccacctacaccaccagtggcggcaagatcccc
atccgctggaccgccccggaggccatttcctaccggaagttcacctctgccagcgacgtg
tggagctttggcattgtcatgtgggaggtgatgacctatggcgagcggccctactgggag
ttgtccaaccacgaggtgatgaaagccatcaatgatggcttccggctccccacacccatg
gactgcccctccgccatctaccagctcatgatgcagtgctggcagcaggagcgtgcccgc
cgccccaagttcgctgacatcgtcagcatcctggacaagctcattcgtgcccctgactcc
ctcaagaccctggctgactttgacccccgcgtgtctatccggctccccagcacgagcggc
tcggagggggtgcccttccgcacggtgtccgagtggctggagtccatcaagatgcagcag
tatacggagcacttcatggcggccggctacactgccatcgagaaggtggtgcagatgacc
aacgacgacatcaagaggattggggtgcggctgcccggccaccagaagcgcatcgcctac
agcctgctgggactcaaggaccaggtgaacactgtggggatccccatctga

DBGET integrated database retrieval system