KEGG   Homo sapiens (human): 197257Help
Entry
197257            CDS       T01001                                 

Gene name
LDHD, DLD
Definition
(RefSeq) lactate dehydrogenase D
  KO
K00102  
D-lactate dehydrogenase (cytochrome) [EC:1.1.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    197257 (LDHD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.4  D-lactate dehydrogenase (cytochrome)
     197257 (LDHD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q86WU2(Tbio)
UniProt: 
Position
16q23.1
AA seq 507 aa AA seqDB search
MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESV
HRCEPPDAVVWPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMD
RILELNQEDFSVVVEPGVTRKALNAHLRDSGLWFPVDPGADASLCGMAATGASGTNAVRY
GTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYSPCVSLGRRKSAAGYN
LTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIE
FLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEA
EERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVG
HVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV
GAVGVETMRQLKAVLDPQGLMNPGKVL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcccgactgctcaggtctgcaacctgggagctgttcccctggaggggctactgctcc
cagaaggcaaagggagagctctgcagggacttcgtagaggctctgaaggccgtggtgggc
ggctcccacgtgtccactgccgcggtggtccgagagcagcacgggcgcgatgagtcggtg
cacaggtgcgaacctcctgatgctgtggtgtggccccagaacgtggagcaggtcagccgg
ctggcagccctgtgctatcgccaaggtgtgcccatcatcccattcggcaccggcaccggg
cttgagggtggcgtctgtgctgtgcagggcggcgtctgcgttaacctgacgcatatggac
cgaatcctggagctgaaccaggaggacttctctgtggtggtggagccaggtgtcacccgc
aaagccctcaacgcccacctgcgggacagcggcctctggtttcccgtggacccaggcgcg
gacgcctctctctgtggcatggcggccaccggggcgtcggggaccaacgcggtccgctac
ggcaccatgcgggacaacgtgctcaacctggaggtggtgctgcccgacgggcggctgctg
cacacggcgggccgaggccggcatttccgcttcggcttctggccagaaatccctcatcac
acagcctggtactcaccttgtgtgtccctgggacgtaggaagagtgcagccggctacaac
ctcacggggctcttcgtgggctccgaggggacgctgggcctcatcacagccaccaccctg
cgcctgcaccctgcccctgaggccacagtggccgccacgtgtgcgttccccagtgtccag
gctgctgtggacagcactgtacacatcctccaggctgcagtgcccgtagcccgcattgag
ttcctggatgaagtcatgatggatgcctgcaacaggtacagcaagctgaattgcttagtg
gcgcccacactcttcctggagttccatggctcccagcaggcactggaggagcagctgcag
cgcacagaggagatagtccagcagaacggagcctctgacttctcctgggccaaggaggcc
gaggagcgcagccggctttggacagcacggcacaatgcctggtacgcagccctggccacg
cggccaggctgcaagggctactccacggatgtgtgtgtgcccatctcccggctgccggag
atcgtggtgcagaccaaggaggatctgaatgcctcaggactcacaggaagcattgtcggg
catgtgggtgacggcaacttccactgcatcctgctggtcaaccctgatgacgccgaggaa
ctgggcagggtcaaggcttttgcagaacagctgggcaggcgggcactggctctccacgga
acgtgcacgggggagcatggcatcggaatgggcaagcggcagctgctgcaggaggaggtg
ggcgccgtgggcgtggagaccatgcggcagctcaaggccgtgctagacccccaaggcctc
atgaatccaggcaaagtgctgtga

DBGET integrated database retrieval system