KEGG   Homo sapiens (human): 197322Help
Entry
197322            CDS       T01001                                 

Gene name
ACSF3
Definition
acyl-CoA synthetase family member 3
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 576 aa AA seqDB search
MLPHVVLTFRRLGCALASCRLAPARHRGSGLLHTAPVARSDRSAPVFTRALAFGDRIALV
DQHGRHTYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGG
VAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGAVE
EPAEVPVPEQGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHKWAWTKDDVILH
VLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLSSETPRINVFMAVPTIYTKL
MEYYDRHFTQPHAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEI
GMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEE
KEGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTG
GYKVSALEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARNV
LAPYAVPSELVLVEEIPRNQMGKIDKKALIRHFHPS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccatgtggtgctcaccttccggcgcctgggctgcgccttggcgtcctgccgg
ctggcgcctgcgagacacagaggaagtggtcttctgcacacagccccagtggcccgctcg
gacaggagcgccccggtgttcacccgtgccctggcctttggggacagaatcgccctggtt
gaccagcacggccgccacacgtacagggagctttattcccgcagccttcgcctgtcccag
gagatctgcaggctctgcgggtgtgtcggcggggacctccgggaggagagggtctccttc
ctatgcgctaacgatgcctcctacgtcgtggcccagtgggcgtcatggatgagtggcggt
gtggcagtccccctctacaggaagcatcccgcggcccagctggagtatgtcatctgcgac
tcccagagctctgtggtccttgccagccaggagtacctggagctcctgagcccggtggtc
aggaagctgggggtcccgctgctgccgctcacaccagccatctacactggagcagtagag
gaaccggcagaggtcccggtcccagagcagggatggaggaacaagggcgccatgatcatc
tacaccagtgggaccacggggaggcccaagggcgtgctgagcacgcaccaaaacatcagg
gctgtggtgaccgggctggtccacaagtgggcatggaccaaagacgacgtgatcctccac
gtgctcccgctgcaccacgtccatggtgtggtcaacgcgctgctctgtcctctctgggtg
ggagccacctgtgtgatgatgcctgagttcagccctcagcaggtttgggaaaagttctta
agttctgaaacgccgcggatcaatgtctttatggcagtgcctacaatatacaccaagctg
atggagtactacgacaggcattttacccagccgcacgcccaggatttcttgcgtgcagtt
tgtgaagaaaaaattaggctgatggtctcaggctcagctgccctgcccctcccagtgctg
gagaagtggaagaacatcacgggccacaccctgctggagcggtatggcatgaccgagatc
ggcatggctctgtccgggcccctgaccactgccgtgcgcctgccaggttccgtggggacc
ccactgcctggagtacaggtgcgcattgtctcagaaaacccacagagggaagcctgctcc
tacaccatccacgcagagggagacgagagggggaccaaggtgaccccagggtttgaagaa
aaggagggggagctgctggtgaggggaccctccgtgtttcgagaatactggaataaacca
gaagaaactaagagtgcattcaccctggatggctggtttaagacaggggacaccgtggtg
tttaaggatggccagtactggatccgaggccggacctcagtggacatcatcaagactgga
ggctacaaggtcagcgccctggaggtggagtggcacctgctggcccaccccagcatcaca
gatgtggctgtgattggagttccggatatgacatggggccagcgggtcactgctgtggtg
accctccgagaaggacactcactgtcccacagggagctcaaagagtgggccagaaatgtc
ctggccccgtacgcggtgccctcggagctggtgctggtggaggagatcccgcggaaccag
atgggcaagattgacaagaaggcgctcatcaggcacttccacccctcatga

DBGET integrated database retrieval system