KEGG   Homo sapiens (human): 197358Help
Entry
197358            CDS       T01001                                 

Gene name
NLRC3, CLR16.2, NOD3
Definition
(RefSeq) NLR family, CARD domain containing 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 1065 aa AA seqDB search
MRKQEVRTGREAGQGHGTGSPAEQVKALMDLLAGKGSQGSQAPQALDRTPDAPLGPCSND
SRIQRHRKALLSKVGGGPELGGPWHRLASLLLVEGLTDLQLREHDFTQVEATRGGGHPAR
TVALDRLFLPLSRVSVPPRVSITIGVAGMGKTTLVRHFVRLWAHGQVGKDFSLVLPLTFR
DLNTHEKLCADRLICSVFPHVGEPSLAVAVPARALLILDGLDECRTPLDFSNTVACTDPK
KEIPVDHLITNIIRGNLFPEVSIWITSRPSASGQIPGGLVDRMTEIRGFNEEEIKVCLEQ
MFPEDQALLGWMLSQVQADRALYLMCTVPAFCRLTGMALGHLWRSRTGPQDAELWPPRTL
CELYSWYFRMALSGEGQEKGKASPRIEQVAHGGRKMVGTLGRLAFHGLLKKKYVFYEQDM
KAFGVDLALLQGAPCSCFLQREETLASSVAYCFTHLSLQEFVAAAYYYGASRRAIFDLFT
ESGVSWPRLGFLTHFRSAAQRAMQAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAQGEHQ
AYRTQVAELLQGCLRPDAAVCARAINVLHCLHELQHTELARSVEEAMESGALARLTGPAH
RAALAYLLQVSDACAQEANLSLSLSQGVLQSLLPQLLYCRKLRLDTNQFQDPVMELLGSV
LSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKI
NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSL
KELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLS
LRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWN
FIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGA
SGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAI
CIATALSGNHRLQHINLQGNHIGDSGARMISEAIKTNAPTCTVEM
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcaagaggtgcggacgggcagggaggccggccagggccacggtacgggctcc
ccagccgagcaggtgaaagccctcatggatctgctggctgggaagggcagtcaaggctcc
caggccccgcaggccctggataggacaccggatgccccgctggggccctgcagcaatgac
tcaaggatacagaggcaccgcaaggccctgctgagcaaggtgggaggtggcccggagctg
ggcggaccctggcacaggctggcctccctcctgctggtggagggcctgacggacctgcag
ctgagggaacacgacttcacacaggtggaggccacccgcgggggcgggcaccccgccagg
accgtcgccctggaccggctcttcctgcctctctcccgggtgtctgtcccaccccgggtc
tccatcactatcggggtggccggcatgggcaagaccaccctggtgaggcacttcgtccgc
ctctgggcccatgggcaggtcggcaaggacttctcgctggtgctgcctctgaccttccgg
gatctcaacacccacgagaagctgtgtgccgaccgactcatctgctcggtcttcccgcac
gtcggggagcccagcctggcggtggcagtcccagccagggccctcctgatcctggacggc
ttggatgagtgcaggacgcctctggacttctccaacaccgtggcctgcacggacccaaag
aaggagatcccggtggaccacctgatcaccaacatcatccgtggcaacctctttccggaa
gtttccatctggatcacctcccgtcccagtgcatctggccagatcccagggggcctggtg
gaccggatgacggagatccggggctttaacgaggaggagatcaaggtgtgtttggagcag
atgttccccgaggaccaggcccttctgggctggatgctgagccaagtgcaggctgacagg
gccctgtacctgatgtgcaccgtcccagccttctgcaggctcacggggatggcgctaggc
cacctgtggcgcagcaggacggggccccaggatgcagagctgtggcccccgaggaccctg
tgcgagctctactcatggtactttaggatggccctcagcggggaggggcaggagaagggc
aaggcaagccctcgcatcgagcaggtggcccatggtggccgcaagatggtggggacattg
ggccgtctggccttccatgggctgctcaagaagaaatacgtgttttacgagcaagacatg
aaggcgtttggtgtagacctcgctctgctgcagggcgccccgtgcagctgcttcctgcag
agagaggagacgttggcatcgtcagtggcctactgcttcacccacctgtccctgcaggag
tttgtggcagccgcgtattactatggcgcatccaggagggccatcttcgacctcttcact
gagagcggcgtatcctggcccaggctgggcttcctcacgcatttcaggagcgcagcccag
cgggccatgcaggcagaggacgggaggctggacgtgttcctgcgcttcctctccggcctc
ttgtctccgagggtcaatgccctcctggccggctccctgctggcccaaggcgagcaccag
gcctaccggacccaggtggctgagctcctgcagggctgcctgcgccccgatgccgcagtc
tgtgcacgggccatcaacgtgttgcactgcctgcatgagctgcagcacaccgagctggcc
cgcagcgtggaggaggccatggagagcggggccctggccaggctgactggtcccgcgcac
cgcgctgccctggcctacctcctgcaggtgtccgacgcctgtgcccaggaggccaacctg
tccctgagcctcagccagggcgtccttcagagcctgctgccccagctgctctactgccgg
aagctcaggctggacaccaaccagttccaggaccccgtgatggagctgctgggcagcgtg
ctgagtgggaaggactgtcgcattcagaagatcagcttggcggagaaccagatcagtaac
aaaggggccaaagctctggccagatccctcttggtcaacagaagtctgacctctctggac
ctccgcggtaactccattggaccacaaggggccaaggcgctggcagacgctttgaagatc
aaccgcaccctgacctccctgagcctccagggcaacaccgttagggatgatggtgccagg
tccatggctgaggccttggcctccaaccggaccctctccatgctgcacctgcagaagaac
agcatcgggcccatgggagcccagcggatggcagatgccttgaagcagaacaggagtctg
aaagagctcatgttctccagtaatagtattggtgatggaggtgccaaggccctggctgag
gccctgaaggtgaaccagggcctggagagcctggacctgcagagcaattccatcagtgac
gcaggagtggcagcactgatgggggccctctgcaccaaccagaccctcctcagcctcagc
cttcgagaaaactccatcagtcccgagggagcccaggccatcgctcatgccctctgcgcc
aacagcaccctgaagaacctggacctgacagccaacctcctccacgaccagggtgcccgg
gccatcgcagtggcagtgagagaaaaccgcaccctcacctcccttcacctgcagtggaac
ttcatccaggccggcgctgcccaggccctgggacaagcactacagctcaacaggagcctc
accagcttagatttacaggagaacgccatcggggatgacggagcgtgtgcggtggcccgt
gcactgaaggtcaacacagccctcactgctctctatctccaggtggcctcaattggtgct
tcaggcgcccaggtgctaggggaagccttggctgtgaacagaaccttggagattctcgac
ttaagaggaaatgccattggggtggctggagccaaagccctggcaaatgctctgaaggta
aactcaagtctccggagactcaatcttcaagagaattctctggggatggacggggcgata
tgcattgccacagcactgtctggaaaccacaggctccagcatatcaatctccagggaaac
cacattggggactccggggccaggatgatctcagaggccatcaagacaaatgctcccacg
tgcactgttgaaatgtga

DBGET integrated database retrieval system