KEGG   Homo sapiens (human): 197358Help
Entry
197358            CDS       T01001                                 

Gene name
NLRC3, CLR16.2, NOD3
Definition
(RefSeq) NLR family CARD domain containing 3
  KO
K22614  NLR family CARD domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Brite
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   197358 (NLRC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 NACHT LRR_4 LRR_8 AAA_30 AAA_19
Motif
Other DBs
NCBI-GeneID: 197358
NCBI-ProteinID: NP_849172
OMIM: 615648
HGNC: 29889
Ensembl: ENSG00000167984
Vega: OTTHUMG00000177561
Pharos: Q7RTR2(Tbio)
UniProt: Q7RTR2 C3VPR7 Q8NF06
Position
16p13.3
AA seq 1065 aa AA seqDB search
MRKQEVRTGREAGQGHGTGSPAEQVKALMDLLAGKGSQGSQAPQALDRTPDAPLGPCSND
SRIQRHRKALLSKVGGGPELGGPWHRLASLLLVEGLTDLQLREHDFTQVEATRGGGHPAR
TVALDRLFLPLSRVSVPPRVSITIGVAGMGKTTLVRHFVRLWAHGQVGKDFSLVLPLTFR
DLNTHEKLCADRLICSVFPHVGEPSLAVAVPARALLILDGLDECRTPLDFSNTVACTDPK
KEIPVDHLITNIIRGNLFPEVSIWITSRPSASGQIPGGLVDRMTEIRGFNEEEIKVCLEQ
MFPEDQALLGWMLSQVQADRALYLMCTVPAFCRLTGMALGHLWRSRTGPQDAELWPPRTL
CELYSWYFRMALSGEGQEKGKASPRIEQVAHGGRKMVGTLGRLAFHGLLKKKYVFYEQDM
KAFGVDLALLQGAPCSCFLQREETLASSVAYCFTHLSLQEFVAAAYYYGASRRAIFDLFT
ESGVSWPRLGFLTHFRSAAQRAMQAEDGRLDVFLRFLSGLLSPRVNALLAGSLLAQGEHQ
AYRTQVAELLQGCLRPDAAVCARAINVLHCLHELQHTELARSVEEAMESGALARLTGPAH
RAALAYLLQVSDACAQEANLSLSLSQGVLQSLLPQLLYCRKLRLDTNQFQDPVMELLGSV
LSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKI
NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSL
KELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLS
LRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWN
FIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGA
SGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAI
CIATALSGNHRLQHINLQGNHIGDSGARMISEAIKTNAPTCTVEM
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcaagaggtgcggacgggcagggaggccggccagggccacggtacgggctcc
ccagccgagcaggtgaaagccctcatggatctgctggctgggaagggcagtcaaggctcc
caggccccgcaggccctggataggacaccggatgccccgctggggccctgcagcaatgac
tcaaggatacagaggcaccgcaaggccctgctgagcaaggtgggaggtggcccggagctg
ggcggaccctggcacaggctggcctccctcctgctggtggagggcctgacggacctgcag
ctgagggaacacgacttcacacaggtggaggccacccgcgggggcgggcaccccgccagg
accgtcgccctggaccggctcttcctgcctctctcccgggtgtctgtcccaccccgggtc
tccatcactatcggggtggccggcatgggcaagaccaccctggtgaggcacttcgtccgc
ctctgggcccatgggcaggtcggcaaggacttctcgctggtgctgcctctgaccttccgg
gatctcaacacccacgagaagctgtgtgccgaccgactcatctgctcggtcttcccgcac
gtcggggagcccagcctggcggtggcagtcccagccagggccctcctgatcctggacggc
ttggatgagtgcaggacgcctctggacttctccaacaccgtggcctgcacggacccaaag
aaggagatcccggtggaccacctgatcaccaacatcatccgtggcaacctctttccggaa
gtttccatctggatcacctcccgtcccagtgcatctggccagatcccagggggcctggtg
gaccggatgacggagatccggggctttaacgaggaggagatcaaggtgtgtttggagcag
atgttccccgaggaccaggcccttctgggctggatgctgagccaagtgcaggctgacagg
gccctgtacctgatgtgcaccgtcccagccttctgcaggctcacggggatggcgctaggc
cacctgtggcgcagcaggacggggccccaggatgcagagctgtggcccccgaggaccctg
tgcgagctctactcatggtactttaggatggccctcagcggggaggggcaggagaagggc
aaggcaagccctcgcatcgagcaggtggcccatggtggccgcaagatggtggggacattg
ggccgtctggccttccatgggctgctcaagaagaaatacgtgttttacgagcaagacatg
aaggcgtttggtgtagacctcgctctgctgcagggcgccccgtgcagctgcttcctgcag
agagaggagacgttggcatcgtcagtggcctactgcttcacccacctgtccctgcaggag
tttgtggcagccgcgtattactatggcgcatccaggagggccatcttcgacctcttcact
gagagcggcgtatcctggcccaggctgggcttcctcacgcatttcaggagcgcagcccag
cgggccatgcaggcagaggacgggaggctggacgtgttcctgcgcttcctctccggcctc
ttgtctccgagggtcaatgccctcctggccggctccctgctggcccaaggcgagcaccag
gcctaccggacccaggtggctgagctcctgcagggctgcctgcgccccgatgccgcagtc
tgtgcacgggccatcaacgtgttgcactgcctgcatgagctgcagcacaccgagctggcc
cgcagcgtggaggaggccatggagagcggggccctggccaggctgactggtcccgcgcac
cgcgctgccctggcctacctcctgcaggtgtccgacgcctgtgcccaggaggccaacctg
tccctgagcctcagccagggcgtccttcagagcctgctgccccagctgctctactgccgg
aagctcaggctggacaccaaccagttccaggaccccgtgatggagctgctgggcagcgtg
ctgagtgggaaggactgtcgcattcagaagatcagcttggcggagaaccagatcagtaac
aaaggggccaaagctctggccagatccctcttggtcaacagaagtctgacctctctggac
ctccgcggtaactccattggaccacaaggggccaaggcgctggcagacgctttgaagatc
aaccgcaccctgacctccctgagcctccagggcaacaccgttagggatgatggtgccagg
tccatggctgaggccttggcctccaaccggaccctctccatgctgcacctgcagaagaac
agcatcgggcccatgggagcccagcggatggcagatgccttgaagcagaacaggagtctg
aaagagctcatgttctccagtaatagtattggtgatggaggtgccaaggccctggctgag
gccctgaaggtgaaccagggcctggagagcctggacctgcagagcaattccatcagtgac
gcaggagtggcagcactgatgggggccctctgcaccaaccagaccctcctcagcctcagc
cttcgagaaaactccatcagtcccgagggagcccaggccatcgctcatgccctctgcgcc
aacagcaccctgaagaacctggacctgacagccaacctcctccacgaccagggtgcccgg
gccatcgcagtggcagtgagagaaaaccgcaccctcacctcccttcacctgcagtggaac
ttcatccaggccggcgctgcccaggccctgggacaagcactacagctcaacaggagcctc
accagcttagatttacaggagaacgccatcggggatgacggagcgtgtgcggtggcccgt
gcactgaaggtcaacacagccctcactgctctctatctccaggtggcctcaattggtgct
tcaggcgcccaggtgctaggggaagccttggctgtgaacagaaccttggagattctcgac
ttaagaggaaatgccattggggtggctggagccaaagccctggcaaatgctctgaaggta
aactcaagtctccggagactcaatcttcaagagaattctctggggatggacggggcgata
tgcattgccacagcactgtctggaaaccacaggctccagcatatcaatctccagggaaac
cacattggggactccggggccaggatgatctcagaggccatcaagacaaatgctcccacg
tgcactgttgaaatgtga

DBGET integrated database retrieval system