KEGG   Homo sapiens (human): 1975Help
Entry
1975              CDS       T01001                                 

Gene name
EIF4B, EIF-4B, PRO1843
Definition
eukaryotic translation initiation factor 4B
Orthology
K03258  
translation initiation factor 4B
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mTOR signaling pathway
PI3K-Akt signaling pathway
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1975 (EIF4B)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1975 (EIF4B)
   04150 mTOR signaling pathway
    1975 (EIF4B)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    1975 (EIF4B)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    1975 (EIF4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 611 aa AA seqDB search
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPK
ENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQT
GNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG
EDENEGEDYAE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaagactatctccctaacagacttt
ctggctgaggatgggggtactggtggaggaagcacctatgtttccaaaccagtcagctgg
gctgatgaaacggatgacctggaaggagatgtttcgaccacttggcacagtaacgatgac
gatgtgtatagggcgcctccaattgaccgttccatccttcccactgctccacgggctgct
cgggaacccaatatcgaccggagccgtcttcccaaatcgccaccctacactgcttttcta
ggaaacctaccctatgatgttacagaagagtcaattaaggaattctttcgaggattaaat
atcagtgcagtgcgtttaccacgtgaacccagcaatccagagaggttgaaaggttttggt
tatgctgaatttgaggacctggattccctgctcagtgccctgagtctcaatgaagagtct
ctaggtaacaggagaattcgagtggacgttgctgatcaagcacaggataaagacagggat
gatcgttcttttggccgtgatagaaatcgggattctgacaaaacagatacagactggagg
gctcgtcctgctacagacagctttgatgactacccacctagaagaggtgatgatagcttt
ggagacaagtatcgagatcgttatgattcagaccggtatcgggatgggtatcgggatggg
tatcgggatggcccacgccgggatatggatcgatatggtggccgggatcgctatgatgac
cgaggcagcagagactatgatagaggctatgattcccggataggcagtggcagaagagca
tttggcagtgggtatcgcagggatgatgactacagaggaggcggggaccgctatgaagac
cgatatgacagacgggatgatcggtcgtggagctccagagatgattactctcgggatgat
tataggcgtgatgatagaggtcccccccaaagacccaaactgaatctaaagcctcggagt
actcctaaggaagatgattcctctgctagtacctcccagtccactcgagctgcttctatc
tttggaggggcaaagcctgttgacacagctgctagagaaagagaagtagaagaacggcta
cagaaggaacaagagaagttgcagcgtcagctggatgagccaaaactagaacgacggcct
cgggagagacacccaagctggcgaagtgaagaaactcaggaacgggaacggtcgaggaca
ggaagtgagtcatcacaaactgggacctccaccacatctagcagaaatgcacgaaggaga
gagagtgagaagtctctagaaaatgaaacactcaataaggaggaagattgccactctcca
acttctaaacctcccaaacctgatcagcccctaaaggtaatgccagcccctccaccaaag
gagaatgcttgggtgaagcgaagttctaaccctcctgctcgatctcagagctcagacaca
gagcagcagtcccctacaagtggtgggggaaaagtagctccagctcaaccatctgaggaa
ggaccaggaaggaaagatgaaaataaagtagatgggatgaatgccccaaaaggccaaact
gggaactctagccgtggtccaggagacggagggaacagagaccactggaaggagtcagat
aggaaagatggcaaaaaggatcaagactccagatctgcacctgagccaaagaaacctgag
gaaaatccagcttccaagttcagttctgcaagcaagtatgctgctctctctgttgatggt
gaagatgaaaatgagggagaagattatgccgaatag

DBGET integrated database retrieval system