KEGG   Homo sapiens (human): 1978Help
Entry
1978              CDS       T01001                                 

Gene name
EIF4EBP1, 4E-BP1, 4EBP1, BP-1, PHAS-I
Definition
eukaryotic translation initiation factor 4E binding protein 1
Orthology
K07205  
eukaryotic translation initiation factor 4E binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Acute myeloid leukemia
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1978 (EIF4EBP1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    1978 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    1978 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    1978 (EIF4EBP1)
   04152 AMPK signaling pathway
    1978 (EIF4EBP1)
   04150 mTOR signaling pathway
    1978 (EIF4EBP1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    1978 (EIF4EBP1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    1978 (EIF4EBP1)
   05221 Acute myeloid leukemia
    1978 (EIF4EBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1978 (EIF4EBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p12
AA seq 118 aa AA seqDB search
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggggcagcagctgcagccagaccccaagccgggccatccccgccactcgccgg
gtggtgctcggcgacggcgtgcagctcccgcccggggactacagcacgacccccggcggc
acgctcttcagcaccaccccgggaggtaccaggatcatctatgaccggaaattcctgatg
gagtgtcggaactcacctgtgaccaaaacacccccaagggatctgcccaccattccgggg
gtcaccagcccttccagtgatgagccccccatggaagccagccagagccacctgcgcaat
agcccagaagataagcgggcgggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system